spacer

EBI Dbfetch

ID   M62335; SV 1; linear; genomic DNA; STD; HUM; 256 BP.
XX
AC   M62335;
XX
DT   29-MAR-1991 (Rel. 27, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human MHC class II HLA DP-beta (allele DPB6), partial cds.
XX
KW   cell surface glycoprotein; class II gene; HLA-DP antigen;
KW   integral membrane glycoprotein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-256
RX   DOI; 10.1007/BF00187094.
RX   PUBMED; 2242906.
RA   Bugawan T.L., Begovich A.B., Erlich H.A.;
RT   "Rapid HLA-DPB typing using enzymatically amplified DNA and nonradioactive
RT   sequence-specific oligonucleotide probes";
RL   Immunogenetics 32(4):231-241(1990).
XX
DR   MD5; eac391692355fa955f2d3ac68bf797b7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..256
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             1..256
FT                   /partial
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II HLA-DP-beta-1"
FT                   /db_xref="GOA:Q30019"
FT                   /db_xref="IMGT/HLA:DPB1*06:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30019"
FT                   /protein_id="AAA59728.1"
FT                   /translation="VYQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELG
FT                   RPDEDYWNSQKDLLEEERAVPDRMCRHNYELDEAVTLQRR"
XX
SQ   Sequence 256 BP; 58 A; 63 C; 96 G; 39 T; 0 other;
     gtgtaccagt tacggcagga atgctacgcg tttaatggga cacagcgctt cctggagaga        60
     tacatctaca accgggagga gttcgtgcgc ttcgacagcg acgtggggga gttccgggcg       120
     gtgacggagc tggggcggcc tgatgaggac tactggaaca gccagaagga cctcctggag       180
     gaggagcggg cagtgccgga caggatgtgc agacacaact acgagctgga cgaggccgtg       240
     accctgcagc gccgag                                                       256
//


spacer
spacer