Dbfetch

ID   M62333; SV 1; linear; genomic DNA; STD; HUM; 256 BP.
XX
AC   M62333;
XX
DT   29-MAR-1991 (Rel. 27, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human MHC class II HLA DP-beta (allele DPB5), partial cds.
XX
KW   cell surface glycoprotein; class II gene; HLA-DP antigen;
KW   integral membrane glycoprotein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-256
RX   DOI; 10.1007/BF00187094.
RX   PUBMED; 2242906.
RA   Bugawan T.L., Begovich A.B., Erlich H.A.;
RT   "Rapid HLA-DPB typing using enzymatically amplified DNA and nonradioactive
RT   sequence-specific oligonucleotide probes";
RL   Immunogenetics 32(4):231-241(1990).
XX
DR   MD5; 040decfb381bbc96de8847d648f8595f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..256
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             1..256
FT                   /partial
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II HLA-DP-beta-1"
FT                   /db_xref="GOA:Q30017"
FT                   /db_xref="IMGT/HLA:DPB1*05:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30017"
FT                   /protein_id="AAA59726.1"
FT                   /translation="LFQGRQECYAFNGTQRFLERYIYNREELVRFDSDVGEFRAVTELG
FT                   RPEAEYWNSQKDILEEKRAVPDRMCRHNYELDEAVTLQRR"
XX
SQ   Sequence 256 BP; 58 A; 64 C; 97 G; 37 T; 0 other;
     cttttccagg gacggcagga atgctacgcg tttaatggga cacagcgctt cctggagaga        60
     tacatctaca accgggagga gctcgtgcgc ttcgacagcg acgtggggga gttccgggcg       120
     gtgacggagc tggggcggcc tgaggcggag tactggaaca gccagaagga catcctggag       180
     gagaagcggg cagtgccgga caggatgtgc agacacaact acgagctgga cgaggccgtg       240
     accctgcagc gccgag                                                       256
//