Dbfetch

ID   M60209; SV 1; linear; genomic DNA; STD; HUM; 241 BP.
XX
AC   M60209; M33693;
XX
DT   16-JAN-1991 (Rel. 26, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC class II HLA-DR-beta-1 gene (DRw14 (allele DRB1-14c)), exon 2.
XX
KW   cell surface glycoprotein; class II gene; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-241
RX   DOI; 10.1007/BF00211645.
RX   PUBMED; 2249880.
RA   Obata F., Ito I., Ito K., Abe A., Ohkubo M., Onda K., Yang Y.G.,
RA   Watanabe K., Kashiwagi N.;
RT   "Sequence analysis and HLA-DR genotyping of a novel HLA-DRw14 allele";
RL   Immunogenetics 32(5):313-320(1990).
XX
DR   MD5; e20166c7c6090250ffe5f0fd279edf20.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..241
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="Japanese ALI"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="HLA-DRw14"
FT                   /clone="pDRB1-14(FO)"
FT                   /cell_line="peripheral blood nucleated cells"
FT                   /db_xref="taxon:9606"
FT   exon            1..241
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II HLA-DR-beta-1-14c"
FT                   /note="G00-120-642"
FT   CDS             1..241
FT                   /partial
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II HLA-DR-beta-1-14c"
FT                   /db_xref="GOA:Q30113"
FT                   /db_xref="IMGT/HLA:DRB1*14:05:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30113"
FT                   /protein_id="AAA63222.1"
FT                   /translation="FLEYSTSECQFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAVT
FT                   ELGRPDAEYWNSQKDLLERRRAEVDTYCRHNYGVV"
XX
SQ   Sequence 241 BP; 49 A; 55 C; 88 G; 49 T; 0 other;
     tttcttggag tactctacgt ctgagtgtca attcttcaat gggacggagc gggtgcggtt        60
     cctggacaga tacttccata accaggagga gttcgtgcgc ttcgacagcg acgtggggga       120
     gtaccgggcg gtgacggagc tggggcggcc tgatgctgag tactggaaca gccagaagga       180
     cctcctggag cggaggcggg ccgaggtgga cacctattgc agacacaact acggggttgt       240
     g                                                                       241
//