Dbfetch

ID   M59865; SV 1; linear; genomic DNA; STD; HUM; 837 BP.
XX
AC   M59865;
XX
DT   15-MAR-1991 (Rel. 27, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC class I HLA-C gene.
XX
KW   cell surface antigen; cell surface glycoprotein; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-837
RX   DOI; 10.1073/pnas.88.5.1676.
RX   PUBMED; 2000377.
RA   Bronson S.K., Pei J., Taillon-Miller P., Chorney M.J., Geraghty D.E.,
RA   Chaplin D.D.;
RT   "Isolation and characterization of yeast artificial chromosome clones
RT   linking the HLA-B and HLA-C loci";
RL   Proc. Natl. Acad. Sci. U.S.A. 88(5):1676-1680(1991).
XX
DR   MD5; 41c19a4ac67faab144403cd3db8bbbf5.
DR   EuropePMC; PMC51087; 2000377.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..837
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="CGM1"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="adult"
FT                   /cell_type="mixed leukocytes"
FT                   /db_xref="taxon:9606"
FT   exon            13..282
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="putative"
FT   CDS             join(13..282,532..805)
FT                   /partial
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /product="MHC cell surface antigen"
FT                   /db_xref="IMGT/HLA:C*08:02:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q29962"
FT                   /protein_id="AAA59659.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAAHTLQRMYGCDLGPD
FT                   GRLLRGYNQFAYDGKDYIALNEDLRSWTAADKAAQITQRKWEAAREAEQRRAYLEGTCV
FT                   EWLRRYLENGKKSLQRAG"
FT   exon            532..805
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="putative"
XX
SQ   Sequence 837 BP; 151 A; 279 C; 296 G; 111 T; 0 other;
     cctcgccccc aggctcccac tccatgaggt atttctacac cgccgtgtcc cggcccggcc        60
     gcggagagcc ccgcttcatc gcagtgggct acgtggacga cacgcagttc gtgcagttcg       120
     acagcgacgc cgcgagtcca agaggggagc cgcgggcgcc gtgggtggag caggaggggc       180
     cggagtattg ggaccgggag acacagaagt acaagcgcca ggcacagact gaccgagtga       240
     gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga ccccggcccg       300
     gggcgcaggt cacgacccct ccccatcccc cacggacggc ccgggtcgcc ccgagtctcc       360
     cggtctgaga tccaccccga ggctgcggaa cccgcccaga ccctcgaccg gagagagccc       420
     cagtcacctt tacccggttt cattttcagt ttaggccaaa atccccgcgg gttggtcggg       480
     gctggggcgg ggctcggggg acggggctga ccacgggggc ggggccaggg tctcacaccc       540
     tccagaggat gtatggctgc gacctggggc ccgacgggcg cctcctccgc gggtataacc       600
     agttcgccta cgacggcaag gattacatcg ccctgaatga ggacctgcgc tcctggaccg       660
     ccgcggacaa ggcggctcag atcacccagc gcaagtggga ggcggcccgt gaggcggagc       720
     agcggagagc ctacctggag ggcacgtgcg tggagtggct ccgcagatac ctggagaacg       780
     ggaagaagag cctgcagcgc gcgggtacca ggggcagtgg ggagccttcc ccatctc          837
//