spacer

EBI Dbfetch

ID   M59841; SV 1; linear; genomic DNA; STD; HUM; 796 BP.
XX
AC   M59841;
XX
DT   15-MAR-1991 (Rel. 27, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC class I HLA-B gene (B8).
XX
KW   cell surface antigen; cell surface glycoprotein; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-796
RX   DOI; 10.1073/pnas.88.5.1676.
RX   PUBMED; 2000377.
RA   Bronson S.K., Pei J., Taillon-Miller P., Chorney M.J., Geraghty D.E.,
RA   Chaplin D.D.;
RT   "Isolation and characterization of yeast artificial chromosome clones
RT   linking the HLA-B and HLA-C loci";
RL   Proc. Natl. Acad. Sci. U.S.A. 88(5):1676-1680(1991).
XX
DR   MD5; 340bf30ab0f4a0bf70ccd4574351d0b4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..796
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="CGM1"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="adult"
FT                   /cell_type="mixed leukocytes"
FT                   /db_xref="taxon:9606"
FT   exon            3..272
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="putative"
FT   CDS             join(3..272,511..785)
FT                   /partial
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC cell surface glycoprotein"
FT                   /db_xref="GOA:Q29942"
FT                   /db_xref="IMGT/HLA:B*08:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q29942"
FT                   /protein_id="AAA59623.1"
FT                   /translation="SHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   VEWLRRYLENGKDSLERA"
FT   exon            511..785
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="putative"
XX
SQ   Sequence 796 BP; 147 A; 263 C; 286 G; 100 T; 0 other;
     aggctcccac tccatgaggt atttcgacac cgccatgtcc cggcccggcc gcggggagcc        60
     ccgcttcatc tcagtgggct acgtggacga cacgcagttc gtgaggttcg acagcgacgc       120
     cgcgagtccg agagaggagc cgcgggcgcc gtggatagag caggaggggc cggagtattg       180
     ggaccggaac acacagatct tcaagaccaa cacacagact gaccgagaga gcctgcggaa       240
     cctgcgcggc tactacaacc agagcgaggc cggtgagtga cccggccgcg caggtcacga       300
     ctccccatcc cccacggacg gcccgggtcg ccccgagtct ccgggtccga gatccgcctc       360
     cctgaggccg ggacccgccc agaccctcga ccggcgagag ccccaggcgc gtttacccgg       420
     tttcattttc agttgaggcc aaaatccccg cgggttggtc ggggcggggc ggggctcggg       480
     gggacggggc tgaccgcggg ccggggccag ggtctcacac cctccagagc atgtacggct       540
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       600
     aggattacat cgccctgaac gaggacctgc gctcctggac cgcggcggac accgcggctc       660
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcaggacaga gcctacctgg       720
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggac agcctggagc       780
     gcgcgggtac cagggg                                                       796
//


spacer
spacer