spacer

EBI Dbfetch

ID   M59840; SV 1; linear; genomic DNA; STD; HUM; 803 BP.
XX
AC   M59840;
XX
DT   15-MAR-1991 (Rel. 27, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC class I HLA-B gene (Bw65).
XX
KW   cell surface antigen; cell surface glycoprotein; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-803
RX   DOI; 10.1073/pnas.88.5.1676.
RX   PUBMED; 2000377.
RA   Bronson S.K., Pei J., Taillon-Miller P., Chorney M.J., Geraghty D.E.,
RA   Chaplin D.D.;
RT   "Isolation and characterization of yeast artificial chromosome clones
RT   linking the HLA-B and HLA-C loci";
RL   Proc. Natl. Acad. Sci. U.S.A. 88(5):1676-1680(1991).
XX
DR   MD5; 0cbb3899404906987a44d8deac5f092c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..803
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="CGM1"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="adult"
FT                   /cell_type="mixed leukocytes"
FT                   /db_xref="taxon:9606"
FT   exon            3..272
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="putative"
FT   CDS             join(3..272,518..792)
FT                   /partial
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC cell surface glycoprotein"
FT                   /db_xref="GOA:O19693"
FT                   /db_xref="IMGT/HLA:B*14:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19693"
FT                   /protein_id="AAA59646.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRNLRGYYNQSEAGSHTLQWMYGCDVGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGTC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            518..792
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="putative"
XX
SQ   Sequence 803 BP; 146 A; 262 C; 292 G; 103 T; 0 other;
     aggctcccac tccatgaggt atttctacac cgccgtgtcc cggcccggcc gcggggagcc        60
     ccgcttcatc tcagtgggct acgtggacga cacgcagttc gtgaggttcg acagcgacgc       120
     cgcgagtccg agagaggagc cgcgggcgcc gtggatagag caggaggggc cggaatattg       180
     ggaccggaac acacagatct gcaagaccaa cacacagact gaccgagaga gcctgcggaa       240
     cctgcgcggc tactacaacc agagcgaggc cggtgagtga ccccggcccg gggcgcaggt       300
     cacgactccc catcccccac ggacggcccg ggtcgccccg agtctccggg tccgagatcc       360
     gcctccctga ggccgcggga cccgcccaga ccctcgaccg gcgagagccc caggcgcgtt       420
     tacccggttt cattttcagt tgaggccaaa atccccgcgg gttgggcggg gcggggcggg       480
     gctcgggggg actgggctga ccgcggggcg gggccagggt ctcacaccct ccagtggatg       540
     tatggctgcg acgtggggcc ggacgggcgc ctcctccgcg ggtataacca gttcgcctac       600
     gacggcaagg attacatcgc cctgaacgag gacctgagct cctggaccgc ggcggacacc       660
     gcggctcaga tcacccagcg caagtgggag gcggcccgtg aggcggagca gctgagagcc       720
     tacctggagg gcacgtgcgt ggagtggctc cgcagacacc tggagaacgg gaaggagacg       780
     ctgcagcgcg cgggtaccag ggg                                               803
//


spacer
spacer