spacer

EBI Dbfetch

ID   M58632; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   M58632; M34372;
XX
DT   05-MAY-1991 (Rel. 28, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class II DRB1*LY10 gene, partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1007/BF02114977.
RX   PUBMED; 2228048.
RA   McClure G.R., Ruberti G., Fathman C.G., Erlich H.A., Begovich A.B.;
RT   "DRB1*LY10--a new DRB1 allele and its haplotypic association";
RL   Immunogenetics 32(3):214-217(1990).
XX
DR   MD5; 342cfc23be854070b1a429a8d750972a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="DRB1*LY10"
FT                   /number=2
FT   gene            1..270
FT                   /gene="DRB1*LY10"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="DRB1*LY10"
FT                   /product="lymphocyte antigen DRB1-LY10"
FT                   /db_xref="GOA:Q30119"
FT                   /db_xref="IMGT/HLA:DRB1*14:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30119"
FT                   /protein_id="AAA36293.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 54 A; 63 C; 102 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgctgc ggagcactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer