spacer

EBI Dbfetch

ID   M58608; SV 1; linear; genomic DNA; STD; HUM; 238 BP.
XX
AC   M58608;
XX
DT   06-APR-1991 (Rel. 28, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class II HLA-DP-beta (HLA-DPB1) gene (HLA-A2, B27,Cw2, DRw8),
DE   exon 2.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-238
RX   DOI; 10.1007/BF00212307.
RX   PUBMED; 1713190.
RA   de Koster H.S., Kenter M.J., D'Amaro J., Luiten R.M., Schroeijers W.E.,
RA   Giphart M.J., Termijtelen A.;
RT   "Positive correlation between oligonucleotide typing and T-cell recognition
RT   of HLA-DP molecules";
RL   Immunogenetics 34(1):12-22(1991).
XX
DR   MD5; 0fd66c0339ef01cc596965b44655b475.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..238
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="HLA-A2,B27,Cw2,DRw8"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..238
FT                   /gene="HLA-DPB1"
FT                   /number=2
FT                   /note="G00-120-636"
FT   CDS             1..238
FT                   /partial
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II HLA-DP-beta"
FT                   /db_xref="GOA:Q30049"
FT                   /db_xref="IMGT/HLA:DPB1*20:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30049"
FT                   /protein_id="AAA59753.1"
FT                   /translation="VYQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELG
FT                   RPDEDYWNSQKDLLEEKRAVPDRMCRHNYELDEA"
XX
SQ   Sequence 238 BP; 56 A; 56 C; 89 G; 37 T; 0 other;
     gtgtaccagt tacggcagga atgctacgcg tttaatggga cacagcgctt cctggagaga        60
     tacatctaca accgggagga gttcgtgcgc ttcgacagcg acgtggggga gttccgggcg       120
     gtgacggagc tggggcggcc tgatgaggac tactggaaca gccagaagga cctcctggag       180
     gagaagcggg cagtgccgga caggatgtgc agacacaact acgagctgga cgaggccg         238
//


spacer
spacer