Dbfetch

ID   M57600; SV 1; linear; genomic DNA; STD; HUM; 255 BP.
XX
AC   M57600; M35183;
XX
DT   06-DEC-1990 (Rel. 26, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-255
RX   DOI; 10.1007/BF00210446.
RX   PUBMED; 1975801.
RA   Petersdorf E.W., Griffith R.L., Erlich H.A., Mickelson E.M., Smith A.G.,
RA   Nisperos B.B., Martin P.J., Hansen J.A.;
RT   "Unique sequences for two HLA-DRB1 genes expressed on distinct DRw6
RT   haplotypes";
RL   Immunogenetics 32(2):96-103(1990).
XX
DR   MD5; 35561751a03f260d73abe87ff629c0f8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..255
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="w6"
FT                   /cell_line="PEV"
FT                   /db_xref="taxon:9606"
FT   exon            1..255
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS             <1..>255
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /note="DR6V; cell surface glycoprotein; integral membrane
FT                   protein"
FT                   /db_xref="GOA:Q30111"
FT                   /db_xref="IMGT/HLA:DRB1*13:05:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30111"
FT                   /protein_id="AAA36292.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFT"
XX
SQ   Sequence 255 BP; 54 A; 61 C; 90 G; 50 T; 0 other;
     cgtttcttgg agtactctac gtctgagtgt catttcttca atgggacgga gcgggtgcgg        60
     ttcctggaca gatacttcca taaccaggag gagaacgtgc gcttcgacag cgacgtgggg       120
     gagttccggg cggtgacgga gctggggcgg cctgatgccg agtactggaa cagccagaag       180
     gacttcctgg aagacaggcg ggccgcggtg gacacctact gcagacacaa ctacggggtt       240
     ggtgagagct tcaca                                                        255
//