Dbfetch

ID   M57599; SV 1; linear; genomic DNA; STD; HUM; 255 BP.
XX
AC   M57599; M35182;
XX
DT   06-DEC-1990 (Rel. 26, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human MHC class II HLA-DRB1 HAG gene (DR6V, w6), exon 2.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-255
RX   DOI; 10.1007/BF00210446.
RX   PUBMED; 1975801.
RA   Petersdorf E.W., Griffith R.L., Erlich H.A., Mickelson E.M., Smith A.G.,
RA   Nisperos B.B., Martin P.J., Hansen J.A.;
RT   "Unique sequences for two HLA-DRB1 genes expressed on distinct DRw6
RT   haplotypes";
RL   Immunogenetics 32(2):96-103(1990).
XX
DR   MD5; 0e244d11390c67c03e669e08708f9f84.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..255
FT                   /organism="Homo sapiens"
FT                   /map="chromosome 6"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="w6"
FT                   /cell_line="HAG"
FT                   /tissue_type="HLA DR6V"
FT                   /db_xref="taxon:9606"
FT   exon            1..255
FT                   /gene="DRB1 HAG"
FT                   /product="MHC DR6V HAG"
FT                   /number=2
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS             <1..>255
FT                   /codon_start=1
FT                   /gene="DRB1 HAG"
FT                   /product="MHC DR6V HAG"
FT                   /db_xref="GOA:Q30110"
FT                   /db_xref="IMGT/HLA:DRB1*13:03:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30110"
FT                   /protein_id="AAA36290.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDILEDKRAAVDTYCRHNYGVGESFT"
XX
SQ   Sequence 255 BP; 56 A; 61 C; 89 G; 49 T; 0 other;
     cgtttcttgg agtactctac gtctgagtgt catttcttca atgggacgga gcgggtgcgg        60
     ttcctggaca gatacttcta taaccaagag gagtacgtgc gcttcgacag cgacgtgggg       120
     gagtaccggg cggtgacgga gctggggcgg cctagcgccg agtactggaa cagccagaag       180
     gacatcctgg aagacaagcg ggccgcggtg gacacctact gcagacacaa ctacggggtt       240
     ggtgagagct tcacg                                                        255
//