Dbfetch

ID   M35159; SV 1; linear; genomic DNA; STD; HUM; 1172 BP.
XX
AC   M35159;
XX
DT   24-JUL-1990 (Rel. 24, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human MHC class II HLA-DR-beta DR2 gene, complete cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1172
RA   Demopulos J.T., Hodge T.W., Wooten V., Acton R.T.;
RT   "A novel DRB1 allele in DR2-positive American blacks";
RL   Unpublished.
XX
DR   MD5; d7431f8f4808fd6dfb26583c5f23a183.
DR   Ensembl-Gn; ENSG00000198502; homo_sapiens.
DR   Ensembl-Tr; ENST00000374975; homo_sapiens.
XX
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by T.W.Hodge, 12-JUN-1990.
CC   A thymidine to cytosine transition at nucleotide position 88
CC   results in an amino acid change from tyrosine to histidine at
CC   residue 30.
CC   Author address: T.W.Hodge;
CC   A-25 Bldg 1  Rm 1226
CC   Centers for Disease Control
CC   1600 Clifton Rd.
CC   Atlanta, GA 30333.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1172
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /strain="African American"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DR2"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     6..92
FT                   /gene="HLA-DRB1"
FT   CDS             6..806
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /note="MHC HLA-DR-beta chain precursor"
FT                   /db_xref="GOA:Q30154"
FT                   /db_xref="HGNC:HGNC:4953"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1FV1"
FT                   /db_xref="PDB:1H15"
FT                   /db_xref="PDB:1HQR"
FT                   /db_xref="PDB:1ZGL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30154"
FT                   /protein_id="AAA59791.1"
FT                   /translation="MVCLKLPGGSYMAKLTVTLMVLSSPLASAGDTRPRFLQQDKYECH
FT                   FFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAV
FT                   DTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNGFYPGSIEVRWFRN
FT                   SQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAQSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFKNQKGHSGLHPTGLVS"
FT   mat_peptide     93..803
FT                   /gene="HLA-DRB1"
FT                   /note="MHC-HLA-DR-beta chain"
XX
SQ   Sequence 1172 BP; 272 A; 315 C; 324 G; 261 T; 0 other;
     ccagcatggt gtgtctgaag ctccctggag gttcctacat ggcaaagctg acagtgacac        60
     tgatggtgct gagctcccca ctggcttcgg ctggggacac ccgaccacgt ttcttgcagc       120
     aggataagta tgagtgtcat ttcttcaacg ggacggagcg ggtgcggttc ctgcacagag       180
     acatctataa ccaagaggag gacttgcgct tcgacagcga cgtgggggag taccgggcgg       240
     tgacggagct ggggcggcct gacgctgagt actggaacag ccagaaggac ttcctggaag       300
     acaggcgcgc cgcggtggac acctactgca gacacaacta cggggttggt gagagcttca       360
     cagtgcagcg gcgagttgag cctaaggtga ctgtgtatcc tgcaaggacc cagaccctgc       420
     agcaccacaa cctcctggtc tgctctgtga atggtttcta tccaggcagc attgaagtca       480
     ggtggttccg gaacagccag gaagagaagg ctggggtggt gtccacaggc ctgattcaga       540
     atggagactg gaccttccag accctggtga tgctggaaac agttcctcga agtggagagg       600
     tttacacctg ccaagtggag cacccaagcg tgacgagccc tctcacagtg gaatggagag       660
     cacagtctga atctgcacag agcaagatgc tgagtggagt cgggggcttt gtgctgggcc       720
     tgctcttcct tggggccggg ctattcatct acttcaagaa tcagaaaggg cactctggac       780
     ttcacccaac aggactcgtg agctgaagtg cagatgacca cattcaaggg ggaaccttct       840
     gccccagctt tgcatgatga aaagctttcc tgcttggctc ttattcttcc acaagagagg       900
     actttctcag gccctggttg ctaccggttc agcaactctg cagaaaatgt ccatccttgt       960
     ggcttcctca gctcctgccc cttggcctga agtcccagca ttgatggcag tgcctcatct      1020
     tcaactttag tgctcccctt tacctaaccc tacggcctcc catgcatctg tactccccct      1080
     gtgtgccaca aatgcactac gttattaaat ttttctgaag cccagagtta aaaatcatct      1140
     gtccacctgg ctccaaagac aaaaaataaa aa                                    1172
//