Dbfetch

ID   M33151; SV 1; linear; mRNA; STD; MUS; 1102 BP.
XX
AC   M33151;
XX
DT   23-MAY-1990 (Rel. 24, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mouse MHC class I H2-L-d glycoprotein mRNA, complete cds.
XX
KW   cell surface antigen; class I gene; H2-L-d glycoprotein;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1102
RX   DOI; 10.1016/0378-1119(91)90054-F.
RX   PUBMED; 1705528.
RA   Joly E., Oldstone M.B.A.;
RT   "Generation of a functional cDNA encoding the LdH2 class-I molecule by
RT   using a single-LTR retroviral shuttle vector";
RL   Gene 97(2):213-221(1991).
XX
DR   MD5; 30fa6c937f2686ed85401320e9824e0b.
DR   EuropePMC; PMC1488955; 16775319.
DR   IMGT/LIGM; M33151.
XX
CC   Draft entry and computer-readable sequence for [Unpublished (1990)
CC   See COMMENT for author address] kindly submitted
CC   by E.Joly, 22-MAR-1990.  Scripps Clinic & Research Foundation,
CC   10666 N. Torrey Pines Road, La Jolla, CA 92037
CC   Entry awaiting author review.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1102
FT                   /organism="Mus musculus"
FT                   /sub_species="domesticus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /haplotype="H-2d"
FT                   /db_xref="taxon:10090"
FT   sig_peptide     10..81
FT                   /note="MHC H2-L-d glycoprotein signal peptide"
FT   CDS             10..1098
FT                   /codon_start=1
FT                   /note="MHC H2-L-d glycoprotein precursor"
FT                   /db_xref="GOA:P01897"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="MGI:MGI:95912"
FT                   /db_xref="PDB:1LD9"
FT                   /db_xref="PDB:1LDP"
FT                   /db_xref="PDB:2E7L"
FT                   /db_xref="PDB:2OI9"
FT                   /db_xref="PDB:3E2H"
FT                   /db_xref="PDB:3E3Q"
FT                   /db_xref="PDB:3ERY"
FT                   /db_xref="PDB:3TF7"
FT                   /db_xref="PDB:3TFK"
FT                   /db_xref="PDB:3TJH"
FT                   /db_xref="PDB:3TPU"
FT                   /db_xref="PDB:3UO1"
FT                   /db_xref="PDB:3UYR"
FT                   /db_xref="PDB:3V4U"
FT                   /db_xref="PDB:3V52"
FT                   /db_xref="PDB:3VJ6"
FT                   /db_xref="PDB:4MS8"
FT                   /db_xref="PDB:4MVB"
FT                   /db_xref="PDB:4MXQ"
FT                   /db_xref="PDB:4N0C"
FT                   /db_xref="PDB:4N5E"
FT                   /db_xref="PDB:4NHU"
FT                   /db_xref="PDB:5VCL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01897"
FT                   /protein_id="AAA39659.1"
FT                   /translation="MGAMAPRTLLLLLAAALAPTQTRAGPHSMRYFETAVSRPGLGEPR
FT                   YISVGYVDNKEFVRFDSDAENPRYEPQAPWMEQEGPEYWERITQIAKGQEQWFRVNLRT
FT                   LLGYYNQSAGGTHTLQWMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLKTWTAADMA
FT                   AQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGE
FT                   VTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNY
FT                   TCRVYHEGLPEPLTLRWEPPPSTDSYMVIVAVLGVLGAMAIIGAVVAFVMKRRRNTGGK
FT                   GGDYALAPGSQSSEMSLRDCKA"
FT   mat_peptide     82..1095
FT                   /note="MHC H2-L-d glycoprotein"
XX
SQ   Sequence 1102 BP; 224 A; 307 C; 371 G; 200 T; 0 other;
     ggatcccaga tgggggcgat ggctccgcgc acgctgctcc tgctgctggc ggccgccctg        60
     gccccgactc agacccgcgc gggcccacac tcgatgcggt atttcgagac cgccgtgtcc       120
     cggcccggcc tcggggagcc ccggtacatc tctgtcggct atgtggacaa caaggagttc       180
     gtgcgcttcg acagcgacgc ggagaatccg agatatgagc cgcaggcgcc gtggatggag       240
     caggaggggc cggagtattg ggagcggatc acgcagatcg ccaagggcca ggagcagtgg       300
     ttccgagtga acctgaggac cctgctcggc tactacaacc agagcgcggg cggcactcac       360
     acactccagt ggatgtacgg ctgtgacgtg gggtcggacg ggcgcctcct ccgcgggtac       420
     gagcagttcg cctacgacgg ctgcgattac atcgccctga acgaagacct gaaaacgtgg       480
     acggcggcgg acatggcggc gcagatcacc cgacgcaagt gggagcaggc tggtgctgca       540
     gagtattaca gggcctacct ggagggcgag tgcgtggagt ggctccacag atacctgaag       600
     aacgggaacg cgacgctgct gcgcacagat tccccaaagg cacatgtgac ccatcacccc       660
     agatctaaag gtgaagtcac cctgaggtgc tgggccctgg gcttctaccc tgctgacatc       720
     accctgacct ggcagttgaa tggggaggag ctgacccagg acatggagct tgtggagacc       780
     aggcctgcag gggatggaac cttccagaag tgggcatctg tggtggtgcc tcttgggaag       840
     gagcagaatt acacatgccg tgtgtaccat gaggggctgc ctgagcccct caccctgaga       900
     tgggagcctc ctccgtccac tgactcttac atggtgatcg ttgctgttct gggtgtcctt       960
     ggagctatgg ccatcattgg agctgtggtg gcttttgtga tgaagagaag gagaaacaca      1020
     ggtggaaaag gaggggacta tgctctggct ccaggctccc agagctctga aatgtctctc      1080
     cgagattgta aagcgtgaat tc                                               1102
//