spacer

EBI Dbfetch

ID   M32800; SV 1; linear; mRNA; STD; HUM; 1309 BP.
XX
AC   M32800;
XX
DT   28-NOV-1990 (Rel. 26, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 19)
XX
DE   Human MHC class I truncated HLA G mRNA, complete cds.
XX
KW   cell surface glycoprotein; class I gene; integral membrane protein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1309
RX   PUBMED; 2295808.
RA   Ellis S.A., Palmer M.S., McMichael A.J.;
RT   "Human trophoblast and the choriocarcinoma cell line BeWo express a
RT   truncated HLA Class I molecule";
RL   J. Immunol. 144(2):731-735(1990).
XX
DR   MD5; a637c127623a3abc57c618feae7d8a4b.
DR   Ensembl-Gn; ENSG00000204632; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206506; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230413; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233095; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235680; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237216; homo_sapiens.
DR   Ensembl-Tr; ENST00000360323; homo_sapiens.
DR   Ensembl-Tr; ENST00000383621; homo_sapiens.
DR   Ensembl-Tr; ENST00000423011; homo_sapiens.
DR   Ensembl-Tr; ENST00000423373; homo_sapiens.
DR   Ensembl-Tr; ENST00000428701; homo_sapiens.
DR   Ensembl-Tr; ENST00000428952; homo_sapiens.
DR   Ensembl-Tr; ENST00000444098; homo_sapiens.
DR   Ensembl-Tr; ENST00000449127; homo_sapiens.
DR   Ensembl-Tr; ENST00000546545; homo_sapiens.
DR   Ensembl-Tr; ENST00000546634; homo_sapiens.
DR   Ensembl-Tr; ENST00000547241; homo_sapiens.
DR   Ensembl-Tr; ENST00000547931; homo_sapiens.
DR   Ensembl-Tr; ENST00000550897; homo_sapiens.
DR   Ensembl-Tr; ENST00000553052; homo_sapiens.
DR   EuropePMC; PMC1351924; 16435885.
DR   EuropePMC; PMC87031; 11340171.
DR   H-InvDB; HIT000195484_04.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1309
FT                   /organism="Homo sapiens"
FT                   /map="6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..1309
FT                   /gene="HLA-G"
FT                   /note="MHC HLA G mRNA; G00-125-675"
FT   CDS             1..1020
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /product="lymphocyte antigen"
FT                   /note="truncated MHC HLA G"
FT                   /db_xref="GOA:Q30182"
FT                   /db_xref="H-InvDB:HIT000195484_03.4"
FT                   /db_xref="IMGT/HLA:G*01:01:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q30182"
FT                   /protein_id="AAA59846.1"
FT                   /translation="MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPR
FT                   FIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQT
FT                   LRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTA
FT                   AQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE
FT                   ATLRCWALGFYPAEIILTWQRDGEDDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQR
FT                   YTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD"
XX
SQ   Sequence 1309 BP; 267 A; 381 C; 403 G; 258 T; 0 other;
     atggtggtca tggcaccccg aaccctcttc ctgctactct cgggggccct gaccctgacc        60
     gagacctggg cgggctccca ctccatgagg tatttcagtg ccgccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccatgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgact cggcgtgtcc gaggatggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccagagtatt gggaagagga gacacggaac accaaggccc acgcacagac tgacagaatg       300
     aacctgcaga ccctgcgcgg ctactacaac cagagcgagg ccagttctca taccctccag       360
     tggatgattg gctgcgacct ggggtcggac ggacgcctcc tccgcgggta tgaacagtat       420
     gcctacgatg gcaaggatta cctcgccctg aacgaggacc tgcgctcctg gaccgcagcg       480
     gacactgcgg ctcagatctc caagcgcaag tgtgaggcgg ccaatgtggc tgaacaaagg       540
     agagcctacc tggagggcac gtgcgtggag tggctccaca gatacctgga gaacgggaag       600
     gagatgctgc agcgcgcgga cccccccaag acacacgtga cccaccaccc tgtctttgac       660
     tatgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat catactgacc       720
     tggcagcggg atggggagga cgaccagacc caggacgtgg agctcgtgga gaccaggcct       780
     gcaggggatg gaaccttcca gaagtgggca gctgtggtgg tgccttctgg agaggagcag       840
     agatacacgt gccatgtgca gcatgagggg ctgccggagc ccctcatgct gagatggaag       900
     cagtcttccc tgcccaccat ccccatcatg ggtatcgttg ctggtctggt tgtccttgca       960
     gctgtagtca ctggagctgc ggtcgctgct gtgctgtgga ggaagaagag ctcagattga      1020
     aaaggaggga gctactctca ggctgcaatg tgaaacagct gccctgtggg actgagtggc      1080
     aagatttgtt catgccttcc ctttgtgact tcaagaaccc tgacttctct ttgtgcagag      1140
     accagcccac ccctgtgccc accatgaccc tcttcctcat gctgaactgc attccttccc      1200
     caatcacctt tcctgttcca gaaaaggggc tgggatgtct ccgtctctgt ctcaaatttg      1260
     tgggccactg agctataact tacttctgta ttaaaattag aatctgagt                  1309
//


spacer
spacer