spacer

EBI Dbfetch

ID   M32507; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   M32507;
XX
DT   16-AUG-1990 (Rel. 25, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 11)
XX
DE   Human MHC HLA-E2.1 gene, exon 3EA2.1, exon 3 alpha-2 domain.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; lymphocyte antigen;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   DOI; 10.1007/BF02114975.
RX   PUBMED; 1977695.
RA   Ohya K., Kondo K., Mizuno S.;
RT   "Polymorphism in the human class I MHC locus HLA-E in Japanese";
RL   Immunogenetics 32(3):205-209(1990).
XX
DR   MD5; 15f87a95fdfbf6b5440627c1741be0e3.
DR   Ensembl-Gn; ENSG00000204592; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225201; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236632; homo_sapiens.
DR   Ensembl-Tr; ENST00000376630; homo_sapiens.
DR   Ensembl-Tr; ENST00000425603; homo_sapiens.
DR   Ensembl-Tr; ENST00000444683; homo_sapiens.
XX
CC   Draft entry and computer-readable [or printed] sequence for
CC   [Immunogenetics (1990) In press]
CC   kindly submitted by S.Mizuno, 14-MAR-1990.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /sub_species="Mongoloid"
FT                   /mol_type="genomic DNA"
FT                   /clone="2.1"
FT                   /cell_type="lymphocyte"
FT                   /tissue_lib="PCRE2.1"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             1..276
FT                   /partial
FT                   /codon_start=1
FT                   /gene="EA2.1"
FT                   /product="MHC HLA-E alpha-2.1"
FT                   /db_xref="GOA:Q30168"
FT                   /db_xref="IMGT/HLA:E*01:03:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q30168"
FT                   /protein_id="AAA63224.1"
FT                   /translation="GSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTA
FT                   VDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHL"
FT   variation       49
FT                   /gene="EA2.1"
FT                   /note="polymorphism site"
XX
SQ   Sequence 276 BP; 62 A; 79 C; 89 G; 46 T; 0 other;
     gggtctcaca ccctgcagtg gatgcatggc tgcgagctgg ggcccgacgg gcgcttcctc        60
     cgcgggtatg aacagttcgc ctacgacggc aaggattatc tcaccctgaa tgaggacctg       120
     cgctcctgga ccgcggtgga cacggcggct cagatctccg agcaaaagtc aaatgatgcc       180
     tctgaggcgg agcaccagag agcctacctg gaagacacat gcgtggagtg gctccacaaa       240
     tacctggaga aggggaagga gacgctgctt cacctg                                 276
//


spacer
spacer