spacer

EBI Dbfetch

ID   M32319; SV 1; linear; mRNA; STD; HUM; 1093 BP.
XX
AC   M32319;
XX
DT   27-JUL-1990 (Rel. 24, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 15)
XX
DE   Human MHC HLA protein, allele B51, complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1093
RX   DOI; 10.1073/pnas.87.7.2833.
RX   PUBMED; 2320591.
RA   Ennis P.D., Zemmour J., Salter R.D., Parham P.;
RT   "Rapid cloning of HLA-A,B cDNA by using the polymerase chain reaction:
RT   frequency and nature of errors produced in amplification";
RL   Proc. Natl. Acad. Sci. U.S.A. 87(7):2833-2837(1990).
XX
DR   MD5; 14460e262f8c32344ed806f755d8e1bd.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
DR   H-InvDB; HIT000195470_03.4.
XX
CC   Authorin copy of sequence [1] kindly submitted by E.Warren,
CC   22-FEB-1990.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1093
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     1..72
FT                   /note="HLA protein signal peptide"
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /note="HLA protein allele B51"
FT                   /db_xref="GOA:P18464"
FT                   /db_xref="H-InvDB:HIT000195470_02.4"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*51:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1E27"
FT                   /db_xref="PDB:1E28"
FT                   /db_xref="PDB:4MJI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18464"
FT                   /protein_id="AAA36232.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   mat_peptide     73..1086
FT                   /note="HLA protein mature peptide"
XX
SQ   Sequence 1093 BP; 228 A; 334 C; 358 G; 173 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat tgcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gaggacggag ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc ttcaagacca acacacagac ttaccgagag       300
     aacctgcgga tcgcgctccg ctactacaac cagagcgagg ccgggtctca cacttggcag       360
     acgatgtatg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca taaccagtac       420
     gcctacgacg gcaaagatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gacacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtccagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgaa aag                                                         1093
//


spacer
spacer