Dbfetch

ID   M32318; SV 1; linear; mRNA; STD; HUM; 1089 BP.
XX
AC   M32318;
XX
DT   27-JUL-1990 (Rel. 24, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 15)
XX
DE   Human MHC HLA protein, allele B57, complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1089
RX   DOI; 10.1073/pnas.87.7.2833.
RX   PUBMED; 2320591.
RA   Ennis P.D., Zemmour J., Salter R.D., Parham P.;
RT   "Rapid cloning of HLA-A,B cDNA by using the polymerase chain reaction:
RT   frequency and nature of errors produced in amplification";
RL   Proc. Natl. Acad. Sci. U.S.A. 87(7):2833-2837(1990).
XX
DR   MD5; 4b8ae0134299183df2bfb7e91cca3738.
DR   EuropePMC; PMC53785; 2320591.
DR   H-InvDB; HIT000195469_03.4.
XX
CC   Authorin copy of sequence [1] kindly submitted by E.Warren,
CC   22-FEB-1990.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     1..72
FT                   /note="HLA protein signal peptide"
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /note="HLA protein allele B57"
FT                   /db_xref="GOA:P18465"
FT                   /db_xref="H-InvDB:HIT000195469_02.4"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*57:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="PDB:2BVO"
FT                   /db_xref="PDB:2BVP"
FT                   /db_xref="PDB:2BVQ"
FT                   /db_xref="PDB:2HJL"
FT                   /db_xref="PDB:2RFX"
FT                   /db_xref="PDB:2YPK"
FT                   /db_xref="PDB:2YPL"
FT                   /db_xref="PDB:3UPR"
FT                   /db_xref="PDB:3VH8"
FT                   /db_xref="PDB:3VRI"
FT                   /db_xref="PDB:3VRJ"
FT                   /db_xref="PDB:3WUW"
FT                   /db_xref="PDB:3X11"
FT                   /db_xref="PDB:3X12"
FT                   /db_xref="PDB:5B38"
FT                   /db_xref="PDB:5B39"
FT                   /db_xref="PDB:5T6W"
FT                   /db_xref="PDB:5T6X"
FT                   /db_xref="PDB:5T6Y"
FT                   /db_xref="PDB:5T6Z"
FT                   /db_xref="PDB:5T70"
FT                   /db_xref="PDB:5U98"
FT                   /db_xref="PDB:5V5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18465"
FT                   /protein_id="AAA36231.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRI
FT                   ALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   mat_peptide     73..1086
FT                   /note="HLA protein mature peptide"
XX
SQ   Sequence 1089 BP; 217 A; 331 C; 366 G; 175 T; 0 other;
     atgcgggtca cggcaccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gaggatggcg ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggacgggga gacacggaac atgaaggcct ccgcgcagac ttaccgagag       300
     aacctgcgga tcgcgctccg ctactacaac cagagcgagg ccgggtctca catcatccag       360
     gtgatgtatg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacatgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccaaagcccc tcaccctgag atgggagcca       900
     tcttcccaat ccaccgtccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtgcagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//