Dbfetch

ID   M32317; SV 1; linear; mRNA; STD; HUM; 1093 BP.
XX
AC   M32317; M35444;
XX
DT   27-JUL-1990 (Rel. 24, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 16)
XX
DE   Homo sapiens HLA protein allele B7 mRNA, complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1093
RX   PUBMED; 2700944.
RA   Parham P., Benjamin R.J., Chen B.P., Clayberger C., Ennis P.D.,
RA   Krensky A.M., Lawlor D.A., Littman D.R., Norment A.M., Orr H.T.,
RA   Salter R.D., Zemmour J.;
RT   "Diversity of class I HLA molecules: Functional and evolutionary
RT   interactions with T cells";
RL   Cold Spring Harb. Symp. Quant. Biol. 54:529-543(1989).
XX
RN   [2]
RP   1-1093
RX   DOI; 10.1073/pnas.87.7.2833.
RX   PUBMED; 2320591.
RA   Ennis P.D., Zemmour J., Salter R.D., Parham P.;
RT   "Rapid cloning of HLA-A,B cDNA by using the polymerase chain reaction:
RT   frequency and nature of errors produced in amplification";
RL   Proc. Natl. Acad. Sci. U.S.A. 87(7):2833-2837(1990).
XX
DR   MD5; a5248889cef1f6dece95924b95bda217.
DR   Ensembl-Gn; ENSG00000234745; homo_sapiens.
DR   Ensembl-Tr; ENST00000412585; homo_sapiens.
DR   EuropePMC; PMC53785; 2320591.
XX
CC   On Feb 8, 2002 this sequence version replaced gi:187695.
CC   Authorin copy of sequence [2] kindly submitted by E.Warren,
CC   22-FEB-1990.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1093
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="JY"
FT                   /cell_type="B-cell"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     1..72
FT                   /note="HLA protein signal peptide"
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /note="HLA protein allele B7"
FT                   /db_xref="GOA:P01889"
FT                   /db_xref="H-InvDB:HIT000195468.15"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*07:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="PDB:3VCL"
FT                   /db_xref="PDB:4U1H"
FT                   /db_xref="PDB:4U1K"
FT                   /db_xref="PDB:5EO0"
FT                   /db_xref="PDB:5EO1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01889"
FT                   /protein_id="AAA36230.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   mat_peptide     73..1086
FT                   /product="HLA protein mature peptide"
XX
SQ   Sequence 1093 BP; 221 A; 335 C; 364 G; 173 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca cctccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat ctcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc tacaaggccc aggcacagac tgaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     agcatgtacg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca tgaccagtac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagcgg       540
     agagcctacc tggagggcga gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gacaagctgg agcgcgctga ccccccaaag acacacgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggtttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagccg       900
     tcttcccagt ccaccgtccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga ggaagagttc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtgcagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgaa aag                                                         1093
//