spacer

EBI Dbfetch

ID   M31781; SV 1; linear; genomic DNA; STD; HUM; 249 BP.
XX
AC   M31781;
XX
DT   26-NOV-1990 (Rel. 25, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class II HLA-DP-beta chain (DPB17) gene, partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-249
RX   DOI; 10.1073/pnas.86.23.9489.
RX   PUBMED; 2512583.
RA   Begovich A.B., Bugawan T.L., Nepom B.S., Klitz W., Nepom G.T., Erlich H.A.;
RT   "A specific HLA-DP beta allele is associated with pauciarticular juvenile
RT   rheumatoid arthritis but not adult rheumatoid arthritis";
RL   Proc. Natl. Acad. Sci. U.S.A. 86(23):9489-9493(1989).
XX
DR   MD5; ea032a744ed2e0bdc395e8b61b49fe51.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..249
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>249
FT                   /codon_start=1
FT                   /note="HLA-DP17-beta chain"
FT                   /db_xref="GOA:Q30048"
FT                   /db_xref="IMGT/HLA:DPB1*17:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30048"
FT                   /protein_id="AAA36258.1"
FT                   /translation="VHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELG
FT                   RPDEDYWNSQKDILEEERAVPDRMCRHNYELDEAVTLQ"
XX
SQ   Sequence 249 BP; 58 A; 60 C; 93 G; 38 T; 0 other;
     gtgcaccagt tacggcagga atgctacgcg tttaatggga cacagcgctt cctggagaga        60
     tacatctaca accgggagga gttcgtgcgc ttcgacagcg acgtggggga gttccgggcg       120
     gtgacggagc tggggcggcc tgatgaggac tactggaaca gccagaagga catcctggag       180
     gaggagcggg cagtgccgga caggatgtgc agacacaact acgagctgga cgaggccgtg       240
     accctgcag                                                               249
//


spacer
spacer