spacer

EBI Dbfetch

ID   M30578; SV 1; linear; genomic DNA; STD; HUM; 1098 BP.
XX
AC   M30578; M28416;
XX
DT   26-NOV-1990 (Rel. 25, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 12)
XX
DE   Human MHC class I HLA-A (A31) gene, complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RX   PUBMED; 2478623.
RA   Kato K., Trapani J.A., Allopenna J., Dupont B., Yang S.Y.;
RT   "Molecular analysis of the serologically defined HLA-Aw19 antigens. A
RT   genetically distinct family of HLA-A antigens comprising A29, A31, A32, and
RT   Aw33, but probably not A30";
RL   J. Immunol. 143(10):3371-3378(1989).
XX
DR   MD5; c2ed9d5fbdb77e66462501d2386a592f.
DR   Ensembl-Gn; ENSG00000231834; homo_sapiens.
DR   Ensembl-Tr; ENST00000456012; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="B-lymphoblastoid cell line JHAF"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1098
FT                   /partial
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /note="HLA-A31 precursor"
FT                   /db_xref="GOA:P16189"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*31:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16189"
FT                   /protein_id="AAA59613.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAHSQIDRVDLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   exon            1..73
FT                   /gene="HLA-A"
FT                   /number=1
FT                   /note="G00-119-310"
FT   sig_peptide     1..72
FT                   /gene="HLA-A"
FT                   /note="HLA-A31 signal peptide; G00-119-310"
FT   mat_peptide     73..1089
FT                   /gene="HLA-A"
FT                   /note="HLA-A31; G00-119-310"
FT   exon            74..343
FT                   /gene="HLA-A"
FT                   /number=2
FT                   /note="G00-119-310"
FT   exon            344..619
FT                   /gene="HLA-A"
FT                   /number=3
FT                   /note="G00-119-310"
FT   exon            620..895
FT                   /gene="HLA-A"
FT                   /number=4
FT                   /note="G00-119-310"
FT   exon            896..1012
FT                   /gene="HLA-A"
FT                   /number=5
FT                   /note="G00-119-310"
FT   exon            1013..1045
FT                   /gene="HLA-A"
FT                   /number=6
FT                   /note="G00-119-310"
FT   exon            1046..1093
FT                   /gene="HLA-A"
FT                   /number=7
FT                   /note="G00-119-310"
FT   exon            1094..1098
FT                   /gene="HLA-A"
FT                   /number=8
FT                   /note="G00-119-310"
XX
SQ   Sequence 1098 BP; 215 A; 327 C; 368 G; 188 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttcacca catccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagagg       240
     cctgagtatt gggaccagga gacacggaat gtgaaggccc actcacagat tgaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccatccag       360
     atgatgtatg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta ccagcaggac       420
     gcctacgacg gcaaggatta catcgccttg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagttg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acgcatatga ctcaccacgc tgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc ttgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcgtct gtggtggtgc cttctggaca ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctc cccaagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctagttct ctttggagct       960
     gtgttcgctg gagctgtggt cgctgctgtg aggtggagga ggaagagctc agatagaaaa      1020
     ggagggagct actctcaggc tgcaagcagt gacagtgccc agggctctga tatgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//


spacer
spacer