spacer

EBI Dbfetch

ID   M30576; SV 1; linear; genomic DNA; STD; HUM; 1098 BP.
XX
AC   M30576; M28414;
XX
DT   26-NOV-1990 (Rel. 25, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC class I HLA-A (A30.3) gene, complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RX   PUBMED; 2478623.
RA   Kato K., Trapani J.A., Allopenna J., Dupont B., Yang S.Y.;
RT   "Molecular analysis of the serologically defined HLA-Aw19 antigens. A
RT   genetically distinct family of HLA-A antigens comprising A29, A31, A32, and
RT   Aw33, but probably not A30";
RL   J. Immunol. 143(10):3371-3378(1989).
XX
DR   MD5; 01d5687a9c47b167b51717dc039d963a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="B-lymphobalstoid cell line LBF"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1098
FT                   /partial
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /note="HLA-A30.3 precursor"
FT                   /db_xref="GOA:P16188"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*30:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16188"
FT                   /protein_id="AAA59612.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTHTWAGSHSMRYFFTSVSRPGSGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARWAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   exon            1..73
FT                   /gene="HLA-A"
FT                   /number=1
FT                   /note="G00-119-310"
FT   sig_peptide     1..72
FT                   /gene="HLA-A"
FT                   /note="HLA-A30.3 signal peptide; G00-119-310"
FT   mat_peptide     73..1095
FT                   /gene="HLA-A"
FT                   /note="HLA-A30.3; G00-119-310"
FT   exon            74..343
FT                   /gene="HLA-A"
FT                   /number=2
FT                   /note="G00-119-310"
FT   exon            344..619
FT                   /gene="HLA-A"
FT                   /number=3
FT                   /note="G00-119-310"
FT   exon            620..895
FT                   /gene="HLA-A"
FT                   /number=4
FT                   /note="G00-119-310"
FT   exon            896..1012
FT                   /gene="HLA-A"
FT                   /number=5
FT                   /note="G00-119-310"
FT   exon            1013..1045
FT                   /gene="HLA-A"
FT                   /number=6
FT                   /note="G00-119-310"
FT   exon            1046..1093
FT                   /gene="HLA-A"
FT                   /number=7
FT                   /note="G00-119-310"
FT   exon            1094..1098
FT                   /gene="HLA-A"
FT                   /number=7
FT                   /note="G00-119-310"
XX
SQ   Sequence 1098 BP; 221 A; 327 C; 366 G; 184 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cacacctggg cgggctccca ctccatgagg tatttcttca catccgtgtc ccggcccggc       120
     agtggagagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagagg       240
     cctgagtatt gggaccagga gacacggaat gtgaaggccc agtcacagac tgaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggttctca caccatccag       360
     ataatgtatg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta tgaacagcac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgttgggc ggagcagttg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acacatatga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagctg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ccttggagct       960
     gtgatcactg gagctgtggt cgctgccgtg atgtggagga ggaagagctc agatagaaaa      1020
     ggagggagtt acactcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//


spacer
spacer