spacer

EBI Dbfetch

ID   M30180; SV 1; linear; mRNA; STD; HUM; 340 BP.
XX
AC   M30180;
XX
DT   26-JUL-1991 (Rel. 28, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class II HLA-DR-beta chain mRNA (DR2,Dw12), partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-340
RX   DOI; 10.1038/324676a0.
RX   PUBMED; 3099214.
RA   Wu S., Saunders T.L., Bach F.H.;
RT   "Polymorphism of human Ia antigens generated by reciprocal intergenic
RT   exchange between two DR beta loci";
RL   Nature 324(6098):676-679(1986).
XX
DR   MD5; 492a5d22d7873075db976016cf0f2ae1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..340
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     <1..58
FT                   /gene="HLA-DRB1"
FT                   /note="MHC HLA-DR-beta chain signal peptide"
FT   CDS             <1..>340
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /note="MHC HLA-DR-beta chain precursor"
FT                   /db_xref="GOA:Q30008"
FT                   /db_xref="IMGT/HLA:DRB1*15:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30008"
FT                   /protein_id="AAA59714.1"
FT                   /translation="CMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRF
FT                   LDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV
FT                   GESFTVQRR"
FT   mat_peptide     59..>340
FT                   /gene="HLA-DRB1"
FT                   /note="MHC HLA-DR-beta chain"
XX
SQ   Sequence 340 BP; 68 A; 88 C; 121 G; 63 T; 0 other;
     ctgcatgaca gcgctgacag tgacactgat ggtgctgagc tccccactgg ctttgtctgg        60
     ggacacccga ccacgtttcc tgtggcagcc taagagggag tgtcatttct tcaatgggac       120
     ggagcgggtg cggttcctgg acagatactt ctataaccag gaggagtccg tgcgcttcga       180
     cagcgacgtg ggggagttcc gggcggtgac ggagctgggg cggcctgacg ctgagtactg       240
     gaacagccag aaggacatcc tggagcaggc gcgggccgcg gtggacacct actgcagaca       300
     caactacggg gttggtgaga gcttcacagt gcagcggcga                             340
//


spacer
spacer