spacer

EBI Dbfetch

ID   M29864; SV 1; linear; genomic DNA; STD; HUM; 822 BP.
XX
AC   M29864;
XX
DT   23-APR-1990 (Rel. 23, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class I HLA-B38 gene (Bw4), partial cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-822
RX   DOI; 10.1007/BF02421207.
RX   PUBMED; 2777338.
RA   Mueller C.A., Engler-Blum G., Gekeler V., Steiert I., Weiss E., Schmidt H.;
RT   "Genetic and serological heterogeneity of the supertypic HLA-B locus
RT   specificities Bw4 and Bw6";
RL   Immunogenetics 30(3):200-207(1989).
XX
DR   MD5; 531fdf12a807cb3024abab84b540e968.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
XX
CC   Though the sequence is of genomic origin, only exons 2-4 were
CC   reported.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>822
FT                   /codon_start=1
FT                   /note="MHC HLA-B38 chain"
FT                   /db_xref="GOA:Q95365"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*38:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q95365"
FT                   /protein_id="AAA36222.1"
FT                   /translation="GSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRE
FT                   EPRAPWIEQEGPEYWDRNTQICKTNTQTYRENLRIALRYYNQSEAGSHTLQRMYGCDVG
FT                   PERRLLRGHNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRTYLEGT
FT                   CVECVRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGE
FT                   DQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
XX
SQ   Sequence 822 BP; 183 A; 258 C; 267 G; 114 T; 0 other;
     ggctcccact ccatgaggta tttctacacc tccgtgtccc ggcccggccg cggggagccc        60
     cgcttcatct cagtgggcta cgtggacgac acgcagttcg tgaggttcga cagcgacgcc       120
     gcgagtccga gagaggagcc gcgggcgccg tggatagagc aggaggggcc ggaatattgg       180
     gaccggaaca cacagatctg caagaccaac acacagactt accgagagaa cctgcggatc       240
     gcgctccgct actacaacca gagcgaggcc gggtctcaca ccctccagag gatgtacggc       300
     tgcgacgtgg ggccggaacg gcgcctcctc cgcgggcata accagttcgc ctacgacggc       360
     aaggattaca tcgccctgaa cgaggacctg agctcctgga ccgccgcgga caccgcggct       420
     cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagctgag aacctacctg       480
     gagggcacgt gcgtggagtg cgtccgcaga tacctggaga acgggaagga gacgctgcag       540
     cgcgcggacc ccccaaagac acatgtgacc caccacccca tctctgacca tgaggccacc       600
     ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat       660
     ggcgaggacc aaactcagga caccgagctt gtggagacca gaccagcagg agacagaacc       720
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat       780
     gtacagcatg aggggctgcc gaagcccctc accctgagat gg                          822
//


spacer
spacer