spacer

EBI Dbfetch

ID   M28207; SV 1; linear; mRNA; STD; HUM; 1282 BP.
XX
AC   M28207;
XX
DT   02-FEB-1990 (Rel. 22, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Homo sapiens (clone pMF17) MHC class I HLA-Cw7 mRNA, 3' end, haplotype
DE   A1/A2,B8/Bw62,Cw3/Cw7.
XX
KW   cell surface glycoprotein; class I gene; integral membrane protein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1282
RX   DOI; 10.1007/BF00352839.
RX   PUBMED; 2714852.
RA   Pohla H., Kuon W., Tabaczewski P., Doerner C., Weiss E.H.;
RT   "Allelic variation in HLA-B and HLA-C sequences and the evolution of the
RT   HLA-B alleles";
RL   Immunogenetics 29(5):297-307(1989).
XX
DR   MD5; 026edb9f52ccf194ed815b521ef350a1.
DR   Ensembl-Gn; ENSG00000204525; homo_sapiens.
DR   Ensembl-Tr; ENST00000376228; homo_sapiens.
XX
CC   On Nov 28, 1994 this sequence version replaced gi:341860.
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by E.H.Weiss 10-JAN-1990.
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by E.H.Weiss 10-JAN-1990.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1282
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="MF"
FT                   /mol_type="mRNA"
FT                   /haplotype="A1/A2,B8/Bw62,Cw3/Cw7"
FT                   /clone="pMF17"
FT                   /cell_type="chronic leukemic T cell"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..873
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /product="MHC class I lymphocyte antigen"
FT                   /db_xref="GOA:P10321"
FT                   /db_xref="H-InvDB:HIT000195222.9"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*07:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:3BZF"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10321"
FT                   /protein_id="AAA53259.1"
FT                   /translation="EQEGPEYWDRETQNYKRQAQADRVSLRNLRGYYNQSEDGSHTLQR
FT                   MYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQL
FT                   RAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITL
FT                   TWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSW
FT                   EPSSQPTIPIVGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGS
FT                   DESLITCKA"
FT   exon            <1..115
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="G00-119-311"
FT   exon            116..391
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="G00-119-311"
FT   exon            392..667
FT                   /gene="HLA-C"
FT                   /number=4
FT                   /note="G00-119-311"
FT   exon            668..787
FT                   /gene="HLA-C"
FT                   /number=5
FT                   /note="G00-119-311"
FT   exon            788..818
FT                   /gene="HLA-C"
FT                   /number=6
FT                   /note="G00-119-311"
FT   exon            819..868
FT                   /gene="HLA-C"
FT                   /number=7
FT                   /note="G00-119-311"
FT   exon            869..1282
FT                   /gene="HLA-C"
FT                   /number=8
FT                   /note="G00-119-311"
FT   regulatory      1266..1271
FT                   /gene="HLA-C"
FT                   /note="G00-119-311"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 1282 BP; 283 A; 366 C; 381 G; 252 T; 0 other;
     gagcaggagg ggccggagta ttgggaccgg gagacacaga actacaagcg ccaggcacag        60
     gctgaccgag tgagcctgcg gaacctgcgc ggctactaca accagagcga ggacgggtct       120
     cacaccctcc agaggatgta tggctgcgac ctggggcccg acgggcgcct cctccgcggg       180
     tatgaccagt ccgcctacga cggcaaggat tacatcgccc tgaacgagga cctgcgctcc       240
     tggaccgccg cggacaccgc ggctcagatc acccagcgca agttggaggc ggcccgtgcg       300
     gcggagcagc tgagagccta cctggagggc acgtgcgtgg agtggctccg cagatacctg       360
     gagaacggga aggagacgct gcagcgcgca gaacccccaa agacacacgt gacccaccac       420
     cccctctctg accatgaggc caccctgagg tgctgggccc tgggcttcta ccctgcggag       480
     atcacactga cctggcagcg ggatggggag gaccagaccc aggacaccga gcttgtggag       540
     accaggccag caggagatgg aaccttccag aagtgggcag ctgtggtggt gccttctgga       600
     caagagcaga gatacacgtg ccatatgcag cacgaggggc tgcaagagcc cctcaccctg       660
     agctgggagc catcttccca gcccaccatc cccatcgtgg gcatcgttgc tggcctggct       720
     gtcctggttg tcctagcggt ccttggagct gtggtcaccg ctatgatgtg taggaggaag       780
     agctcaggtg gaaaaggagg gagctgctct caggctgcgt gcagcaacag tgcccagggc       840
     tctgatgagt ctctcatcac ttgtaaagcc tgagacagct gcctgtgtgg gactgagatg       900
     caggatttct tcacacctct cctttgtgac ttcaagagcc tctggcatct ctttctgcaa       960
     aggcgtctga atgtgtctgc gttcctgtta gcataatgtg aggaggtgga gacagcccac      1020
     ccccgtgtcc accgtgaccc ctgtccccac actgacctgt gttccctccc cgatcatctt      1080
     tcctgttcca gagaggtggg gctggatgtc tccatctctg tctcaaattc atggtgcact      1140
     gagctgcaac ttcttacttc cctaatgaag ttaagaacct gaatataaat ttgtgttctc      1200
     aaatatttgc tatgaagcgt tgatggatta attaaataag tcaattccta gaagttgaga      1260
     gagcaaataa agacctgaga ac                                               1282
//


spacer
spacer