Dbfetch

ID   M28206; SV 1; linear; mRNA; STD; HUM; 1458 BP.
XX
AC   M28206;
XX
DT   02-FEB-1990 (Rel. 22, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Homo sapiens (clone pMS1) MHC class I HLA-Cw6 mRNA, 3' end, haplotype
DE   A2/A30,B13,Cw6.
XX
KW   cell surface glycoprotein; class I gene; integral membrane protein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1458
RX   DOI; 10.1007/BF00352839.
RX   PUBMED; 2714852.
RA   Pohla H., Kuon W., Tabaczewski P., Doerner C., Weiss E.H.;
RT   "Allelic variation in HLA-B and HLA-C sequences and the evolution of the
RT   HLA-B alleles";
RL   Immunogenetics 29(5):297-307(1989).
XX
DR   MD5; 8bc19895f05b8340e4889cc1e1b79da5.
DR   Ensembl-Gn; ENSG00000228299; homo_sapiens.
DR   Ensembl-Tr; ENST00000420206; homo_sapiens.
XX
CC   On Nov 28, 1994 this sequence version replaced gi:341859.
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by E.H.Weiss 10-JAN-1990.
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by E.H.Weiss 10-JAN-1990.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1458
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="MS"
FT                   /mol_type="mRNA"
FT                   /haplotype="A2/A30,B13,Cw6"
FT                   /clone="pMS1"
FT                   /cell_type="thymocyte"
FT                   /db_xref="taxon:9606"
FT   gene            1..1458
FT                   /gene="HLA-C"
FT   exon            <1..11
FT                   /gene="HLA-C"
FT                   /number=1
FT                   /note="G00-119-311"
FT   CDS             <1..1040
FT                   /codon_start=2
FT                   /gene="HLA-C"
FT                   /product="MHC class I lymphocyte antigen"
FT                   /db_xref="GOA:Q29963"
FT                   /db_xref="H-InvDB:HIT000195221.9"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*06:02:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29963"
FT                   /protein_id="AAA57258.1"
FT                   /translation="TWACSHSMRYFCTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAAS
FT                   PRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQWMYGC
FT                   DLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYL
FT                   EGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQR
FT                   DGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSS
FT                   QPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGGKGGSCSQAASSNSAQGSDESL
FT                   IACKA"
FT   sig_peptide     <1..10
FT                   /gene="HLA-C"
FT                   /note="G00-119-311"
FT   mat_peptide     11..1036
FT                   /gene="HLA-C"
FT                   /product="MHC class I lymphocyte antigen"
FT                   /note="G00-119-311"
FT   exon            12..281
FT                   /gene="HLA-C"
FT                   /number=2
FT                   /note="G00-119-311"
FT   exon            282..557
FT                   /gene="HLA-C"
FT                   /number=3
FT                   /note="G00-119-311"
FT   exon            558..833
FT                   /gene="HLA-C"
FT                   /number=4
FT                   /note="G00-119-311"
FT   exon            834..953
FT                   /gene="HLA-C"
FT                   /number=5
FT                   /note="G00-119-311"
FT   exon            954..985
FT                   /gene="HLA-C"
FT                   /number=6
FT                   /note="G00-119-311"
FT   exon            986..1034
FT                   /gene="HLA-C"
FT                   /number=7
FT                   /note="G00-119-311"
FT   exon            1035..1458
FT                   /gene="HLA-C"
FT                   /number=8
FT                   /note="G00-119-311"
FT   regulatory      1434..1439
FT                   /gene="HLA-C"
FT                   /note="G00-119-311"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1458
FT                   /gene="HLA-C"
FT                   /note="G00-119-311"
XX
SQ   Sequence 1458 BP; 311 A; 416 C; 445 G; 286 T; 0 other;
     gacctgggcc tgctcccact ccatgaggta tttctgcacc gccgtgtccc ggcccggccg        60
     cggagagccc cgcttcatct cagtgggcta cgtggacgac acgcagttcg tgcggttcga       120
     cagcgacgcc gcgagtccga gaggggagcc ccgggcgccg tgggtggagc aggaggggcc       180
     ggagtattgg gaccgggaga cacagaagta caagcgccag gcacaggctg accgagtgaa       240
     cctgcggaaa ctgcgcggct actacaacca gagcgaggac gggtctcaca ccctccagtg       300
     gatgtatggc tgcgacctgg ggcccgacgg acgcctcctc cgcgggtatg accagtccgc       360
     ctacgacggc aaggattaca tcgccctgaa cgaggacctg cgctcctgga ccgccgcgga       420
     cacggcggct cagatcaccc agcgcaagtg ggaggcggcc cgtgaggcgg agcagtggag       480
     agcctacctg gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga       540
     gacgctgcag cgcgcggaac acccaaagac acacgtgacc caccatcccg tctctgacca       600
     tgaggccacc ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg       660
     gcagcgggat ggcgaggacc aaactcagga caccgagctt gtggagacca ggccagcagg       720
     agatggaacc ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata       780
     cacgtgccat gtgcagcacg aggggctgcc agagcccctc accctgagat gggagccatc       840
     ttcccagccc accatcccca tcgtgggcat cgttgctggc ctggctgtcc tggctgtcct       900
     agcggtccta ggagctgtga tggctgttgt gatgtgtagg aggaagagct caggtggaaa       960
     aggagggagc tgctctcagg ctgcgtccag caacagtgcc cagggctctg atgagtctct      1020
     catcgcttgt aaagcctgag acagctgcct gtgtgggact gagatgcagg atttcttcac      1080
     acctctcctt tgtgacttca agagcctctg gcatctcttt ctgcaaaggc tatctgaatg      1140
     tgtctgcgtt cctgttagca taatgtgagg aggtggagag acagcccacc cccgtgtcca      1200
     ccgtgacccc tgtccccaca ctgacctgtg ttccctcccc gatcatcttt cctgttccag      1260
     agaagtgggc tggatgtctc catctctgtc tcaactttac ggtgtactga gctgcaactt      1320
     cttacttccc tactgaaaat aagaatctga atataaattt gttttctcaa atatttgcta      1380
     tgagaggttg atggattaat taaataagtc aattcctgga agttgagaga gcaaataaag      1440
     acctgagaac cttccaga                                                    1458
//