Dbfetch

ID   M28205; SV 1; linear; mRNA; STD; HUM; 1516 BP.
XX
AC   M28205;
XX
DT   02-FEB-1990 (Rel. 22, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens MHC class I HLA-B51 mRNA, complete cds, haplotype A2,
DE   B27/B51,Cw2/Cw3.
XX
KW   cell surface glycoprotein; class I gene; integral membrane protein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1516
RX   DOI; 10.1007/BF00352839.
RX   PUBMED; 2714852.
RA   Pohla H., Kuon W., Tabaczewski P., Doerner C., Weiss E.H.;
RT   "Allelic variation in HLA-B and HLA-C sequences and the evolution of the
RT   HLA-B alleles";
RL   Immunogenetics 29(5):297-307(1989).
XX
DR   MD5; 1730920c1801320b6daaffd323d66b9b.
XX
CC   On Nov 28, 1994 this sequence version replaced gi:341858.
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by E.H.Weiss 10-JAN-1990.
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by E.H.Weiss 10-JAN-1990.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1516
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="healthy donor"
FT                   /mol_type="mRNA"
FT                   /haplotype="A2,B27/B51,Cw2/Cw3"
FT                   /cell_type="peripheral white blood cell"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     1..72
FT                   /partial
FT                   /gene="HLA-B"
FT                   /note="G00-120-048"
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I lymphocyte antigen"
FT                   /db_xref="GOA:Q29938"
FT                   /db_xref="H-InvDB:HIT000195220.14"
FT                   /db_xref="IMGT/HLA:B*51:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q29938"
FT                   /protein_id="AAA57145.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRT
FT                   RLRYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="G00-120-048"
FT   mat_peptide     73..1086
FT                   /gene="HLA-B"
FT                   /product="MHC class I lymphocyte antigen"
FT                   /note="G00-120-048"
FT   exon            74..343
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="G00-120-048"
FT   exon            344..619
FT                   /gene="HLA-B"
FT                   /number=3
FT   exon            620..895
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="G00-120-048"
FT   exon            896..1012
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="G00-120-048"
FT   exon            1013..1043
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="G00-120-048"
FT   exon            1044..1093
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="G00-120-048"
FT   exon            1094..1516
FT                   /gene="HLA-B"
FT                   /number=8
FT                   /note="G00-120-048"
FT   regulatory      1492..1497
FT                   /gene="HLA-B"
FT                   /note="G00-120-048"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 1516 BP; 327 A; 434 C; 451 G; 304 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat tgcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gaggacggag ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc ttcaagacca acacacagac ttaccgagag       300
     aacctgcgga ctcggctccg ctactacaac cagagcgagg ccgggtctca cacttggcag       360
     acgatgtatg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca taaccagtac       420
     gcctacgacg gcaaagatta catcgccctg aacgaggacc tgagctcctg gaccgccgcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gacacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtccagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgaa aagcctgaga cagctgtctt gtgagggctg agatgcagga tttgttcact      1140
     cctccccttt gtgacttcaa gagcctctgg catctctttc tgcaaaggca cctgaatgtg      1200
     tctgcgttcc tgttagcata atgtgaggag gtggagagac agcccaccct tgtgtccact      1260
     gtgacccctg ttcccatgct gacctgtgtt tcctccccag tcatctttct tgttccagag      1320
     aggtggggct ggatgtctcc atctctgtct caactttatg tgcactgagc tgcaacttct      1380
     tacttcccta ctgaaaataa gaatctgaat atacatttgt tttctcaaat atttgctatg      1440
     agaggttgat ggattaatta aataagtcaa ttcctggaat gtgagagagc aaataaagac      1500
     ctgagaacct tccaga                                                      1516
//