spacer

EBI Dbfetch

ID   M28204; SV 1; linear; mRNA; STD; HUM; 1479 BP.
XX
AC   M28204;
XX
DT   02-FEB-1990 (Rel. 22, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Homo sapiens (clone pMF28) MHC class I HLA-Bw62 mRNA, 3' end, haplotype
DE   A1/A2,B8/Bw62,Cw3/Cw7.
XX
KW   cell surface glycoprotein; class I gene; integral membrane protein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1479
RX   DOI; 10.1007/BF00352839.
RX   PUBMED; 2714852.
RA   Pohla H., Kuon W., Tabaczewski P., Doerner C., Weiss E.H.;
RT   "Allelic variation in HLA-B and HLA-C sequences and the evolution of the
RT   HLA-B alleles";
RL   Immunogenetics 29(5):297-307(1989).
XX
DR   MD5; 6322e0c400a0588c080ef44d81ad06d3.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
XX
CC   On Nov 28, 1994 this sequence version replaced gi:341857.
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by E.H.Weiss 10-JAN-1990.
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by E.H.Weiss 10-JAN-1990.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1479
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="MF"
FT                   /mol_type="mRNA"
FT                   /haplotype="A1/A2,B8/Bw62,Cw3/Cw7"
FT                   /clone="pMF28"
FT                   /cell_type="chronic leukemic T cell"
FT                   /db_xref="taxon:9606"
FT   exon            <1..37
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="G00-120-048"
FT   CDS             <1..1053
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I lymphocyte antigen"
FT                   /db_xref="GOA:O19691"
FT                   /db_xref="IMGT/HLA:B*08:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:O19691"
FT                   /protein_id="AAA53257.1"
FT                   /translation="LSAALALTETWAGSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQF
FT                   VRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGS
FT                   HTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAR
FT                   VAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYP
FT                   AEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKP
FT                   LTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDS
FT                   AQGSDVSLTA"
FT   sig_peptide     <1..36
FT                   /gene="HLA-B"
FT                   /note="G00-120-048"
FT   mat_peptide     37..1050
FT                   /gene="HLA-B"
FT                   /product="MHC class I lymphocyte antigen"
FT                   /note="G00-120-048"
FT   exon            38..307
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="G00-120-048"
FT   exon            308..583
FT                   /gene="HLA-B"
FT                   /number=3
FT   exon            584..859
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="G00-120-048"
FT   exon            860..976
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="G00-120-048"
FT   exon            977..1008
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="G00-120-048"
FT   exon            1009..1057
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="G00-120-048"
FT   exon            1058..1479
FT                   /gene="HLA-B"
FT                   /number=8
FT                   /note="G00-120-048"
FT   polyA_signal    1457..1462
FT                   /gene="HLA-B"
FT                   /note="G00-120-048"
XX
SQ   Sequence 1479 BP; 321 A; 423 C; 444 G; 291 T; 0 other;
     ctctcggcgg ccctggccct gaccgagacc tgggccggct cccactccat gaggtatttc        60
     gacaccgcca tgtcccgacc cggccgcggg gagccccgct tcatctcagt gggctacgtg       120
     gacgacacgc agttcgtgag gttcgacagc gacgccgcga gtccgagaga ggagccgcgg       180
     gcgccgtgga tagagcagga ggggccggag tattgggacc ggaacacaca gatcttcaag       240
     accaacacac agactgaccg agagagcctg cggaacctgc gcggctacta caaccagagc       300
     gaggccgggt ctcacaccct ccagagcatg tacggctgcg acgtggggcc ggacgggcgc       360
     ctcctccgcg ggcataacca gtacgcctac gacggcaagg attacatcgc cctgaacgag       420
     gacctgcgct cctggaccgc ggcggacacg gcggctcaga tcacccagcg caagtgggag       480
     gcggcccgtg tggcggagca ggacagagcc tacctggagg gcacgtgcgt ggagtggctc       540
     cgcagatacc tggagaacgg gaaggacacg ctggagcgcg cggacccccc aaagacacac       600
     gtgacccacc accccatctc tgaccatgag gccaccctga ggtgctgggc cctgggcttc       660
     taccctgcgg agatcacact gacctggcag cgggatggcg aggaccaaac tcaggacact       720
     gagcttgtgg agaccagacc agcaggagat agaaccttcc agaagtgggc agctgtggtg       780
     gtgccttctg gagaagagca gagatacaca tgccatgtac agcatgaggg gctgccgaag       840
     cccctcaccc tgagatggga gccgtcttcc cagtccaccg tccccatcgt gggcattgtt       900
     gctggcctgg ctgtcctagc agttgtggtc atcggagctg tggtcgctgc tgtgatgtgt       960
     aggaggaaga gctcaggtgg aaaaggaggg agctactctc aggctgcgtg cagcgacagt      1020
     gcccagggct ctgatgtgtc tctcacagct tgaaaagcct gagacagctg tcttgtgagg      1080
     gactgagatg caggatttct tcacgcctcc cctttgtgac ttcaagagcc tctgcgatct      1140
     ctttctgcaa aggcacctga atgtgtctgc gtccctgtta gcataatgtg aggaggtgga      1200
     gagacagccc acccttgtgt ccactgtgac ccctgttccc atgctgacct gtgtttcctc      1260
     cccagtcatc tttcttgttc cagagaggtg gggctggatg tctccatctc tgtctcaact      1320
     ttacgtgcac tgagctgcaa cttcttactt ccctactgaa aataagaatc tgaatataaa      1380
     tttgttttct caaatatttg ctatgagagg ttgatggatt aattaaataa gtcaattcct      1440
     ggaatttgaa agagcaaata aagacctgag accttccag                             1479
//


spacer
spacer