spacer

EBI Dbfetch

ID   M28203; SV 1; linear; mRNA; STD; HUM; 1497 BP.
XX
AC   M28203;
XX
DT   02-FEB-1990 (Rel. 22, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Homo sapiens (clone pMF18) MHC class I HLA-Bw62 mRNA, 3' end, haplotype
DE   A1/A2,B8/Bw62,Cw3/Cw7.
XX
KW   cell surface glycoprotein; class I gene; integral membrane protein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1497
RX   DOI; 10.1007/BF00352839.
RX   PUBMED; 2714852.
RA   Pohla H., Kuon W., Tabaczewski P., Doerner C., Weiss E.H.;
RT   "Allelic variation in HLA-B and HLA-C sequences and the evolution of the
RT   HLA-B alleles";
RL   Immunogenetics 29(5):297-307(1989).
XX
DR   MD5; e3d2823b34c8cc24a8e80a4a9ac60389.
DR   Ensembl-Gn; ENSG00000232126; homo_sapiens.
DR   Ensembl-Tr; ENST00000450871; homo_sapiens.
XX
CC   On Nov 28, 1994 this sequence version replaced gi:341856.
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by E.H.Weiss 10-JAN-1990.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1497
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="MF"
FT                   /mol_type="mRNA"
FT                   /haplotype="A1/A2,B8/Bw62,Cw3/Cw7"
FT                   /clone="pMF18"
FT                   /cell_type="chronic leukemic T cell"
FT                   /db_xref="taxon:9606"
FT   exon            <1..62
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="G00-120-048"
FT   CDS             <1..1079
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /product="MHC class I lymphocyte antigen"
FT                   /db_xref="GOA:P30464"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*15:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1XR8"
FT                   /db_xref="PDB:1XR9"
FT                   /db_xref="PDB:3C9N"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30464"
FT                   /protein_id="AAA53258.1"
FT                   /translation="APRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPRFIAV
FT                   GYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGY
FT                   YNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQIT
FT                   QRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLR
FT                   CWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHV
FT                   QHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGKGGSY
FT                   SQAASSDSAQGSDVSLTA"
FT   sig_peptide     <1..61
FT                   /gene="HLA-B"
FT                   /note="G00-120-048"
FT   mat_peptide     62..1075
FT                   /gene="HLA-B"
FT                   /product="MHC class I lymphocyte antigen"
FT                   /note="G00-120-048"
FT   exon            63..332
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="G00-120-048"
FT   exon            333..608
FT                   /gene="HLA-B"
FT                   /number=3
FT   exon            609..884
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="G00-120-048"
FT   exon            885..1001
FT                   /gene="HLA-B"
FT                   /number=5
FT                   /note="G00-120-048"
FT   exon            1002..1032
FT                   /gene="HLA-B"
FT                   /number=6
FT                   /note="G00-120-048"
FT   exon            1033..1082
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="G00-120-048"
FT   exon            1083..1497
FT                   /gene="HLA-B"
FT                   /number=8
FT                   /note="G00-120-048"
FT   regulatory      1482..1487
FT                   /gene="HLA-B"
FT                   /note="G00-120-048"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 1497 BP; 321 A; 432 C; 448 G; 296 T; 0 other;
     ggcgccccga accgtcctcc tgctgctctc gggagccctg gccctgaccg agacctgggc        60
     cggctcccac tccatgaggt atttctacac cgccatgtcc cggcccggcc gcggggagcc       120
     ccgcttcatc gcagtgggct acgtggacga cacccagttc gtgaggttcg acagcgacgc       180
     cgcgagtccg aggatggcgc cccgggcgcc atggatagag caggaggggc cggagtattg       240
     ggaccgggag acacagatct ccaagaccaa cacacagact taccgagaga gcctgcggaa       300
     cctgcgcggc tactacaacc agagcgaggc cgggtctcac accctccaga ggatgtacgg       360
     ctgcgacgtg gggccggacg ggcgcctcct ccgcgggcat gaccagtccg cctacgacgg       420
     caaggattac atcgccctga acgaggacct gagctcctgg accgcggcgg acacggcggc       480
     tcagatcacc cagcgcaagt gggaggcggc ccgtgaggcg gagcagtgga gagcctacct       540
     ggagggcctg tgcgtggagt ggctccgcag atacctggag aacgggaagg agacgctgca       600
     gcgcgcggac cccccaaaga cacatgtgac ccaccacccc atctctgacc atgaggccac       660
     cctgaggtgc tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga       720
     tggcgaggac caaactcagg acaccgagct tgtggagacc agaccagcag gagatagaac       780
     cttccagaag tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacatgcca       840
     tgtacagcat gaggggctgc cgaagcccct caccctgaga tgggagccat cttcccagtc       900
     caccatcccc atcgtgggca ttgttgctgg cctggctgtc ctagcagttg tggtcatcgg       960
     agctgtggtc gctactgtga tgtgtaggag gaagagctca ggtggaaaag gagggagcta      1020
     ctctcaggct gcgtccagcg acagtgccca gggctctgat gtgtctctca cagcttgaaa      1080
     agcctgagac agctgtcttg tgagggaccg agatgcagga tttcttcacg cctccccttt      1140
     gtgacttcaa gagcctctgg catctctttc tgcaaaggca cctgaatgtg tctgcgtccc      1200
     tgttagcata atgtgaggag gtggagagac agcccaccct tgtgtccact gtgacccctg      1260
     ttcccatgct gatctgtgtt tcctccccag tcatctttct tgttccagag aggtggggct      1320
     ggatgtctcc atctctgtct caactttatg tgcactgagc tgcaacttct tacttcccta      1380
     ctgaaaataa gaatctgaat ataaatttgt tttctcaaat atttgctatg agaggttgat      1440
     ggattaatta aataagtcaa ttcctggaat ttgaaagagc aaataaagac ctgagac         1497
//


spacer
spacer