spacer

EBI Dbfetch

ID   M28160; SV 1; linear; mRNA; STD; HUM; 1482 BP.
XX
AC   M28160;
XX
DT   02-FEB-1990 (Rel. 22, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human lymphocyte antigen (HLA CW6) JTW1 mRNA, complete cds, clone JTW1.
XX
KW   lymphocyte antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1482
RX   DOI; 10.1007/BF00352842.
RX   PUBMED; 2714853.
RA   Mizuno S., Kang S.H., Lee H.W., Trapani J.A., Dupont B., Yang S.Y.;
RT   "Isolation and expression of a cDNA clone encoding HLA-Cw6: unique
RT   characteristics of HLA-C encoded gene products";
RL   Immunogenetics 29(5):323-330(1989).
XX
DR   MD5; 8592265ee867e035a3f694f82e092ba7.
DR   Ensembl-Gn; ENSG00000228299; homo_sapiens.
DR   Ensembl-Tr; ENST00000420206; homo_sapiens.
XX
CC   On Aug 20, 1994 this sequence version replaced gi:341841.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1482
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             5..1105
FT                   /codon_start=1
FT                   /product="lymphocyte antigen"
FT                   /note="CW6"
FT                   /db_xref="GOA:Q29963"
FT                   /db_xref="H-InvDB:HIT000195213.14"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*06:02:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29963"
FT                   /protein_id="AAA36235.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEDGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGTCVEWLRRYLENGKESLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
XX
SQ   Sequence 1482 BP; 302 A; 436 C; 455 G; 289 T; 0 other;
     cgggatgcgg gtcatggcgc cccgaaccct catcctgctg ctctcgggag ccctggccct        60
     gaccgagacc tgggcctgct cccactccat gaggtatttc gacaccgccg tgtcccggcc       120
     cggccgcgga gagccccgct tcatctcagt gggctacgtg gacgacacgc agttcgtgcg       180
     gttcgacagc gacgccgcga gtccgagagg ggagccccgg gcgccgtggg tggagcagga       240
     ggggccggag tattgggacc gggagacaca gaagtacaag cgccaggcac aggctgaccg       300
     agtgaacctg cggaaactgc gcggctacta caaccagagc gaggacgggt ctcacaccct       360
     ccagtggatg tatggctgcg acctggggcc cgacgggcgc ctcctccgcg ggtatgacca       420
     gtccgcctac gacggcaagg attacatcgc cctgaacgag gacctgcgct cctggaccgc       480
     cgcggacacg gcggctcaga tcacccagcg caagtgggag gcggcccgtg aggcggagca       540
     gtggagagcc tacctggagg gcacgtgcgt ggagtggctc cgcagatacc tggagaacgg       600
     gaaggagagc ctgcagcgcg cggaacaccc aaagacacac gtgacccacc atcccgtctc       660
     tgaccatgag gccaccctga ggtgctgggc cctgggcttc taccctgcgg agatcacact       720
     gacctggcag cgggatggcg aggaccaaac tcaggacacc gagcttgtgg agaccaggcc       780
     agcaggagat ggaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaagagca       840
     gagatacacg tgccatgtgc agcacgaggg gctgccagag cccctcaccc tgagatggga       900
     gccatcttcc cagcccacca tccccatcgt gggcatcgtt gctggcctgg ctgtcctggc       960
     tgtcctagct gtcctaggag ctgtgatggc tgttgtgatg tgtaggagga agagctcagg      1020
     tggaaaagga gggagctgct ctcaggctgc gtccagcaac agtgcccagg gctctgatga      1080
     gtctctcatc gcttgtaaag cctgagacag ctgcctgtgt gggactgaga tgcaggattt      1140
     cttcacacct ctcctttgtg acttcaagag cctctggcat ctctttctgc aaaggcatct      1200
     gaatgtgtct gcgttcctgt tagcataatg tgaggaggtg gagagacagc ccaccccgtg      1260
     tccaccgtga cccctgtccc cacactgacc tgtgttccct ccccgatcat ctttcctgtt      1320
     ccagagaagt gggctggatg tctccatctc tgtctcaact ttacgtgtac tgagctgcaa      1380
     cttcttactt ccctactgaa aataagaatc tgaatataaa tttgttttct caaatatttg      1440
     ctatgagagg ttgatggatt aattaaataa gtcaattccc cg                         1482
//


spacer
spacer