spacer

EBI Dbfetch

ID   M28115; SV 1; linear; genomic DNA; STD; HUM; 44 BP.
XX
AC   M28115;
XX
DT   01-FEB-1990 (Rel. 22, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human MHC class I HLA-B35 gene, exon 7 and complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-44
RX   DOI; 10.1007/BF02421534.
RX   PUBMED; 2788131.
RA   Ooba T., Hayashi H., Karaki S., Tanabe M., Kano K., Takiguchi M.;
RT   "The structure of HLA-B35 suggests that it is derived from HLA-Bw58 by two
RT   genetic mechanisms";
RL   Immunogenetics 30(2):76-80(1989).
XX
DR   MD5; ef8c3f2d9f3c1d18e8f2a85c90cd63a1.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
XX
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by M.Takiguchi, 08-SEP-1989. HLA class I molecules are polymorphic
CC   glycoproteins that are expressed on most somatic cells. NCBI gi:
CC   187671
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..44
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="periferal lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(M28109.1:<1..73,M28110.1:1..270,M28111.1:1..276,
FT                   M28112.1:1..276,M28113.1:1..117,M28114.1:1..33,1..44)
FT                   /map="chromosome 7"
FT                   /codon_start=1
FT                   /gene="HLA-B35"
FT                   /product="cell surface glycoprotein"
FT                   /note="NCBI gi: 187673"
FT                   /db_xref="GOA:P30685"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*35:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1A1N"
FT                   /db_xref="PDB:1A9B"
FT                   /db_xref="PDB:1A9E"
FT                   /db_xref="PDB:1CG9"
FT                   /db_xref="PDB:1XH3"
FT                   /db_xref="PDB:1ZHK"
FT                   /db_xref="PDB:1ZHL"
FT                   /db_xref="PDB:1ZSD"
FT                   /db_xref="PDB:2AK4"
FT                   /db_xref="PDB:2AXF"
FT                   /db_xref="PDB:2AXG"
FT                   /db_xref="PDB:2CIK"
FT                   /db_xref="PDB:2FYY"
FT                   /db_xref="PDB:2FZ3"
FT                   /db_xref="PDB:2H6P"
FT                   /db_xref="PDB:2NW3"
FT                   /db_xref="PDB:2NX5"
FT                   /db_xref="PDB:3BW9"
FT                   /db_xref="PDB:3BWA"
FT                   /db_xref="PDB:3KWW"
FT                   /db_xref="PDB:3KXF"
FT                   /db_xref="PDB:3LKN"
FT                   /db_xref="PDB:3LKO"
FT                   /db_xref="PDB:3LKP"
FT                   /db_xref="PDB:3LKQ"
FT                   /db_xref="PDB:3LKR"
FT                   /db_xref="PDB:3LKS"
FT                   /db_xref="PDB:3MV7"
FT                   /db_xref="PDB:3MV8"
FT                   /db_xref="PDB:3MV9"
FT                   /db_xref="PDB:3VFS"
FT                   /db_xref="PDB:3VFT"
FT                   /db_xref="PDB:3VFU"
FT                   /db_xref="PDB:3VFV"
FT                   /db_xref="PDB:3VFW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30685"
FT                   /protein_id="AAA59617.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            1..>44
FT                   /map="chromosome 7"
FT                   /gene="HLA-B35"
FT                   /number=7
XX
SQ   Sequence 44 BP; 8 A; 14 C; 12 G; 10 T; 0 other;
     ccagcgacag tgcccagggc tctgatgtgt ctctcacagc ttga                         44
//


spacer
spacer