spacer

EBI Dbfetch

ID   M27645; SV 1; linear; genomic DNA; STD; HUM; 282 BP.
XX
AC   M27645;
XX
DT   02-FEB-1990 (Rel. 22, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Homo sapiens AMALA (Dw16) cell line sequence.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-282
RX   DOI; 10.1016/0198-8859(89)90054-2.
RX   PUBMED; 2466818.
RA   Gorski J.;
RT   "First domain sequence of the HLA-DRB1 chain from two HLA-DRw14 homozygous
RT   typing cell lines: TEM (Dw9) and AMALA (Dw16)";
RL   Hum. Immunol. 24(2):145-149(1989).
XX
DR   MD5; 114cb2929b15d1ec50c011d5d531407b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..282
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="AMALA (Dw19)"
FT                   /db_xref="taxon:9606"
FT   CDS             1..282
FT                   /partial
FT                   /codon_start=1
FT                   /db_xref="GOA:Q13750"
FT                   /db_xref="IMGT/HLA:DRB1*14:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q13750"
FT                   /protein_id="AAA72783.1"
FT                   /translation="GDTRPRFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVG
FT                   EYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 282 BP; 61 A; 69 C; 103 G; 49 T; 0 other;
     ggggacacca gaccacgttt cttggagtac tctacgtctg agtgtcattt cttcaatggg        60
     acggagcggg tgcggttcct ggagagatac ttccataacc aggaggagaa cgtgcgcttc       120
     gacagcgacg tgggggagta ccgggcggtg acggagctgg ggcggcctga tgccgagtac       180
     tggaacagcc agaaggacct cctggagcag aggcgggccg cggtggacac ctactgcaga       240
     cacaactacg gggttggtga gagcttcaca gtgcagcggc ga                          282
//


spacer
spacer