Dbfetch

ID   M27644; SV 1; linear; genomic DNA; STD; HUM; 282 BP.
XX
AC   M27644;
XX
DT   02-FEB-1990 (Rel. 22, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Homo sapiens TEM (Dw9) cell line sequence.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-282
RX   DOI; 10.1016/0198-8859(89)90054-2.
RX   PUBMED; 2466818.
RA   Gorski J.;
RT   "First domain sequence of the HLA-DRB1 chain from two HLA-DRw14 homozygous
RT   typing cell lines: TEM (Dw9) and AMALA (Dw16)";
RL   Hum. Immunol. 24(2):145-149(1989).
XX
DR   MD5; e0ccaabd543fdfda5ab7c7666953e6ba.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..282
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="TEM"
FT                   /db_xref="taxon:9606"
FT   CDS             1..282
FT                   /partial
FT                   /codon_start=1
FT                   /db_xref="GOA:Q31646"
FT                   /db_xref="IMGT/HLA:DRB1*14:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q31646"
FT                   /protein_id="AAA72782.1"
FT                   /translation="GDTRPRFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVG
FT                   EYRAVTELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 282 BP; 58 A; 69 C; 104 G; 51 T; 0 other;
     ggggacacca gaccacgttt cttggagtac tctacgtctg agtgtcattt cttcaatggg        60
     acggagcggg tgcggttcct ggacagatac ttccataacc aggaggagtt cgtgcgcttc       120
     gacagcgacg tgggggagta ccgggcggtg acggagctgg ggcggcctgc tgcggagcac       180
     tggaacagcc agaaggacct cctggagcgg aggcgggccg aggtggacac ctattgcaga       240
     cacaactacg gggttgtgga gagcttcaca gtgcagcggc ga                          282
//