spacer

EBI Dbfetch

ID   M27635; SV 1; linear; mRNA; STD; HUM; 1139 BP.
XX
AC   M27635;
XX
DT   02-FEB-1990 (Rel. 22, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens MHC HLA-DRw12 allele mRNA, beta-1 chain, complete cds.
XX
KW   lymphocyte antigen; major histocompatibility complex;
KW   major histocompatibility complex class II.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1139
RX   DOI; 10.1016/0198-8859(89)90069-4.
RX   PUBMED; 2541120.
RA   Navarrete C., Seki T., Miranda A., Winchester R., Gregersen P.K.;
RT   "DNA sequence analysis of the HLA-DRw12 allele";
RL   Hum. Immunol. 25(1):51-58(1989).
XX
DR   MD5; 4109f7ec541678f1a59c460d196f4d3d.
DR   H-InvDB; HIT000195180_04.4.
XX
CC   On Nov 21, 1995 this sequence version replaced gi:341739.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1139
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="9"
FT                   /cell_line="HERLUFF"
FT                   /db_xref="taxon:9606"
FT   gene            38..838
FT                   /gene="HLA-DRw12"
FT   CDS             38..838
FT                   /codon_start=1
FT                   /gene="HLA-DRw12"
FT                   /product="lymphocyte antigen"
FT                   /note="beta-1 chain"
FT                   /db_xref="GOA:Q29901"
FT                   /db_xref="H-InvDB:HIT000195180_03.4"
FT                   /db_xref="IMGT/HLA:DRB1*12:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29901"
FT                   /protein_id="AAA81550.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTGECY
FT                   FFNGTERVRLLERHFHNQEELLRFDSDVGEFRAVTELGRPVAESWNSQKDILEDRRAAV
FT                   DTYCRHNYGAVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMPETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS"
XX
SQ   Sequence 1139 BP; 236 A; 310 C; 327 G; 266 T; 0 other;
     tgctgctctg gcccctggtc ctgtcctgtt ctccagcatg gtgtgtctga ggctccctgg        60
     aggctcctgc atggcagttc tgacagtgac actgatggtg ctgagctccc cactggcttt       120
     ggctggggac accagaccac gtttcttgga gtactctacg ggtgagtgtt atttcttcaa       180
     tgggacggag cgggtgcggt tactggagag acacttccat aaccaggagg agctcctgcg       240
     cttcgacagc gacgtggggg agttccgggc ggtgacggag ctggggcggc ctgtcgccga       300
     gtcctggaac agccagaagg acatcctgga agacaggcgc gccgcggtgg acacctattg       360
     cagacacaac tacggggctg tggagagctt cacagtgcag cggcgagtcc atcctaaggt       420
     gactgtgtat ccttcaaaga cccagcccct gcagcaccac aacctcctgg tctgttctgt       480
     gagtggtttc tatccaggca gcattgaagt caggtggttc cggaatggcc aggaagagaa       540
     gactggggtg gtgtccacgg gcctgatcca caatggagac tggaccttcc agaccctggt       600
     gatgccggaa acagttcctc ggagtggaga ggtttacacc tgccaagtgg agcacccaag       660
     cgtgacaagc cctctcacag tggaatggag agcacggtct gaatctgcac agagcaagat       720
     gctgagtgga gtcgggggct ttgtgctggg cctgctcttc cttggggccg ggctgttcat       780
     ctacttcagg aatcagaaag gacactctgg acttcagcca agaggattcc tgagctgaag       840
     tgcagatgac acattcaaag aagaactttc tgccccagct ttgaaggatg aaaagctttc       900
     cctcctggct gttattcttc cacaagagag ggctttctca ggacctggtt gctactggtt       960
     cagcaactgc agaaaatgtc ctcccttgtg gcttcctcag ctcctgccct tggcctgaag      1020
     tcccagcatt ggtggcagcg cctcatcttc aacttttgtg ctcccctttg cctaaaccct      1080
     atggcctcct gtgcatctgt actcaccctg taccacaaac acattacatt attaaatgc       1139
//


spacer
spacer