spacer

EBI Dbfetch

ID   M27510; SV 1; linear; genomic DNA; STD; HUM; 241 BP.
XX
AC   M27510;
XX
DT   23-APR-1990 (Rel. 23, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human MHC class II HLA-DR-beta-1 chain gene (DRw12b), exon 2.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-241
RX   DOI; 10.1007/BF02421173.
RX   PUBMED; 2592019.
RA   Abe A., Ito I., Ohkubo M., Kaneko T., Ito K., Kato H., Kashiwagi N.,
RA   Obata F.;
RT   "Two distinct subtypes of the HLA-DRw12 haplotypes in the Japanese
RT   population detected by nucleotide sequence analysis and oligonucleotide
RT   genotyping";
RL   Immunogenetics 30(6):422-426(1989).
XX
DR   MD5; 9891d80e30cc795b2e685ec7e5f9c0ce.
XX
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by F.Obata, 21-AUG-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..241
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>241
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT                   /note="MHC HLA-DR beta-1 chain, old gene name 'HLA-DR'"
FT                   /db_xref="GOA:Q30107"
FT                   /db_xref="IMGT/HLA:DRB1*12:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30107"
FT                   /protein_id="AAA59816.1"
FT                   /translation="FLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAVT
FT                   ELGRPVAESWNSQKDFLEDRRAAVDTYCRHNYGAV"
XX
SQ   Sequence 241 BP; 47 A; 59 C; 87 G; 48 T; 0 other;
     tttcttggag tactctacgg gtgagtgtta tttcttcaat gggacggagc gggtgcggtt        60
     actggagaga cacttccata accaggagga gctcctgcgc ttcgacagcg acgtggggga       120
     gttccgggcg gtgacggagc tggggcggcc tgtcgccgag tcctggaaca gccagaagga       180
     cttcctggaa gacaggcgcg ccgcggtgga cacctattgc agacacaact acggggctgt       240
     g                                                                       241
//


spacer
spacer