spacer

EBI Dbfetch

ID   M25325; SV 1; linear; mRNA; STD; HUM; 460 BP.
XX
AC   M25325;
XX
DT   23-NOV-1989 (Rel. 21, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens MHC HLA-DBQ3 allele DQw3.1 mRNA, 5' end.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-460
RX   DOI; 10.1007/BF00373644.
RX   PUBMED; 2925231.
RA   Hiraiwa A., Seyfried C.E., Nepom G.T., Milner E.C.;
RT   "Sequence analysis of HLA class II domains: characterization of the DQw3
RT   family of DQB genes";
RL   Immunogenetics 29(3):186-190(1989).
XX
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Tr; ENST00000399065; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000424530; homo_sapiens.
DR   Ensembl-Tr; ENST00000480749; homo_sapiens.
XX
CC   On Jan 10, 1995 this sequence version replaced gi:341331.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..460
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /haplotype="DQB3.1"
FT                   /cell_line="EBV-transformed LCL"
FT                   /cell_type="B lymphoblastoid cell"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     83..178
FT                   /gene="HLA-DQB3"
FT                   /standard_name="DQw3"
FT   CDS             83..>460
FT                   /codon_start=1
FT                   /gene="HLA-DQB3"
FT                   /standard_name="DQw3.1"
FT                   /product="lymphocyte antigen"
FT                   /db_xref="GOA:Q29965"
FT                   /db_xref="H-InvDB:HIT000194991.9"
FT                   /db_xref="IMGT/HLA:DQB1*03:01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29965"
FT                   /protein_id="AAA59675.1"
FT                   /translation="MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKA
FT                   MCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTR
FT                   AELDTVCRHNYQLELRTTLQRR"
FT   mat_peptide     179..>460
FT                   /gene="HLA-DQB3"
FT                   /standard_name="DQw3.1"
FT                   /product="lymphocyte antigen"
XX
SQ   Sequence 460 BP; 98 A; 124 C; 138 G; 100 T; 0 other;
     tttttattct ttctgccagg tacatcagat ccatcaggtc cgagctgtgt tgactaccac        60
     tacttttccc ttcgtctcaa ttatgtcttg gaaaaaggct ttgcggatcc ccggaggcct       120
     tcgggcagca actgttacct tgatgctggc gatgctgagc accccagtgg ctgagggcag       180
     agactctccc gaggatttcg tgtaccagtt taaggccatg tgctacttca ccaacgggac       240
     ggagcgcgtg cgttatgtga ccagatacat ctataaccga gaggagtacg cacgcttcga       300
     cagcgacgtg gaggtgtacc gggcggtgac gccgctgggg ccgcctgacg ccgagtactg       360
     gaacagccag aaggaagtcc tggagaggac ccgggcggag ttggacacgg tgtgcagaca       420
     caactaccag ttggagctcc gcacgacctt gcagcggcga                             460
//


spacer
spacer