Dbfetch

ID   M24096; SV 1; linear; mRNA; STD; HUM; 1365 BP.
XX
AC   M24096;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC class I HLA-C-alpha-2 chain mRNA, partial cds, clone 9.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex;
KW   transplantation antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1365
RX   DOI; 10.1007/BF00395855.
RX   PUBMED; 2914713.
RA   Cianetti L., Testa U., Scotto L., La Valle R., Simeone A., Boccoli G.,
RA   Giannella G., Peschle C., Boncinelli E.;
RT   "Three new class I HLA alleles: structure of mRNAs and alternative
RT   mechanisms of processing";
RL   Immunogenetics 29(2):80-91(1989).
XX
DR   MD5; 523abe76f7a8845b8fb5ecb0078a8f3f.
DR   H-InvDB; HIT000194914_03.4.
DR   H-InvDB; HIT000194914_04.4.
XX
CC   Draft entry and computer readable copy of sequence for [1] kindly
CC   provided by L.Cianetti, 21-APR-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1365
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="GM637"
FT                   /cell_type="primary fibroblast"
FT                   /db_xref="taxon:9606"
FT   mat_peptide     <1..948
FT                   /gene="HLA-C"
FT                   /note="MHC HLA-C-alpha-2 chain"
FT   CDS             <1..951
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /note="MHC HLA-C-alpha-2 chain precursor"
FT                   /db_xref="GOA:Q29958"
FT                   /db_xref="H-InvDB:HIT000194914_02.4"
FT                   /db_xref="IMGT/HLA:C*15:02:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q29958"
FT                   /protein_id="AAA59654.1"
FT                   /translation="YVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQA
FT                   QTDRVNLRKLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQLAYDGKDYIALNEHL
FT                   RSWTAADTAAQITQRKWEAAREAEQLRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHV
FT                   THHPVSDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVV
FT                   VPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVV
FT                   MCRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA"
XX
SQ   Sequence 1365 BP; 301 A; 379 C; 416 G; 269 T; 0 other;
     tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagtcc aagaggggag        60
     ccgcgggcgc cgtgggtgga gcaggagggg ccggagtatt gggaccggga gacacagaac       120
     tacaagcgcc aggcacagac tgaccgagtg aacctgcgga aactgcgcgg ctactacaac       180
     cagagcgagg ccgggtctca catcatccag aggatgtatg gctgcgacct ggggcccgac       240
     gggcgcctcc tccgcgggca tgaccagtta gcctacgacg gcaaggatta catcgccctg       300
     aacgagcacc tgcgctcctg gaccgccgcg gacacggcgg ctcagatcac ccagcgcaag       360
     tgggaggcgg cccgtgaggc ggagcagctg agagcctacc tggagggcac gtgcgtggag       420
     tggctccgca gatacctgga gaacgggaag gagacgctgc agcgcgcgga acacccaaag       480
     acacacgtga cccaccatcc cgtctctgac catgaggcca ccctgaggtg ctgggccctg       540
     ggcttctacc ctgcggagat cacactgacc tggcagcggg atggcgagga gcaaactcag       600
     gacaccgagc ttgtggagac caggccagca ggagatggaa ccttccagaa gtgggcagct       660
     gtggtggtgc cttctggaga agagcagaga tacacgtgcc atgtgcagca cgaggggctg       720
     ccggagcccc tcaccctgag atgggagcca tcttcccagc ccaccatccc catcgtgggc       780
     atcgttgctg gcctggctgt cctggctgtc ctagctgtcc taggagctgt gatggctgtt       840
     gtgatgtgta ggaggaagag ctcaggtgga aaaggaggga gctgctctca ggctgcgtcc       900
     agcaacagtg cccagggctc tgatgagtct ctcatcgctt gtaaagcctg agacagctgc       960
     ctgtgtggga ctgagatgga ggatttcttc acacctctcc tttgtgactt caagagcctc      1020
     tggcatctct ttctgcaaag gcatctgaat gtgtctgcgt tcctgttagc ataatgtgag      1080
     gaggtggaga gacagcccac ccccgtgtcc accgtgaccc ctgtccccac actgacctgt      1140
     gttccctccc cgatcatctt tcctgttcca gagaagtggg ctggatgtct ccatctctgt      1200
     ctcaacttta cgtgtactga gctgcaactt cttacttccc tactgaaaat aagaatctga      1260
     atataaattt gttttctcaa atatttgcta tgagaggttg atggattaat taaataagtc      1320
     aattcctgga agttgagaga gcaaataaag acctgagaac cttcc                      1365
//