spacer

EBI Dbfetch

ID   M24095; SV 1; linear; mRNA; STD; HUM; 1443 BP.
XX
AC   M24095;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 12)
XX
DE   Human MHC class I HLA-A10-alpha-2 chain mRNA, partial cds, clone 8/16.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex;
KW   transplantation antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1443
RX   DOI; 10.1007/BF00395855.
RX   PUBMED; 2914713.
RA   Cianetti L., Testa U., Scotto L., La Valle R., Simeone A., Boccoli G.,
RA   Giannella G., Peschle C., Boncinelli E.;
RT   "Three new class I HLA alleles: structure of mRNAs and alternative
RT   mechanisms of processing";
RL   Immunogenetics 29(2):80-91(1989).
XX
DR   MD5; 1c889eee3711cf47e89405cc0f85a844.
DR   Ensembl-Gn; ENSG00000206505; homo_sapiens.
DR   Ensembl-Tr; ENST00000383605; homo_sapiens.
DR   Ensembl-Tr; ENST00000549224; homo_sapiens.
XX
CC   Draft entry and computer readable copy of sequence for [1] kindly
CC   provided by L.Cianetti, 21-APR-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1443
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="GM637"
FT                   /cell_type="primary fibroblast"
FT                   /db_xref="taxon:9606"
FT   mat_peptide     <1..1017
FT                   /gene="HLA-A"
FT                   /note="MHC HLA-A-alpha-2 chain"
FT   CDS             <1..1020
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /note="MHC HLA-A10-alpha-2 chain precursor"
FT                   /db_xref="GOA:P30450"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*26:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30450"
FT                   /protein_id="AAA59655.1"
FT                   /translation="HSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEP
FT                   RAPWIEQEGPEYWDRNTRNVKAHSQTDRANLGTLRGYYNQSEDGSHTIQRMYGCDVGPD
FT                   GRFLRGYQQDAYDGKDYIALNEHLRSWTAGDMAAQITQRKWETAHEAEQWRAYLEGRCV
FT                   EWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQ
FT                   TQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSSQPTIP
FT                   IVGIIAGLVLFGAVIAGAVVAAVMWRRKSSDRKGGSYSQAASSDSAQGSDMSLTACKV"
XX
SQ   Sequence 1443 BP; 311 A; 402 C; 440 G; 290 T; 0 other;
     cactccatga ggtatttcta cacctccgtg tcccggcccg gccgcgggga gccccgcttc        60
     atcgccgtgg gctacgtgga cgacacgcag ttcgtgcggt tcgacagcga cgccgcgagc       120
     cagaggatgg agccgcgggc gccgtggata gagcaggagg ggccggagta ttgggaccgg       180
     aacacacgga atgtgaaggc ccactcacag actgaccgag cgaacctggg gaccctgcgc       240
     ggctactaca accagagcga ggacggttct cacaccatcc agaggatgta tggctgcgac       300
     gtggggccgg acgggcgctt cctccgcggg taccagcagg acgcttacga cggcaaggat       360
     tacatcgccc tgaacgagca cctgcgctct tggaccgcgg gcgacatggc ggctcagatc       420
     acccagcgca agtgggagac ggcccatgag gcggagcagt ggagagccta cctggagggc       480
     cggtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct gcagcgcacg       540
     gacgccccca agacgcatat gactcaccac gctgtctctg accatgaggc caccctgagg       600
     tgctgggccc tgagcttcta ccctgcggag atcacactga cctggcagcg ggatggggag       660
     gaccagaccc aggacacgga gctcgtggag accaggcctg caggggatgg gaccttccag       720
     aagtgggcgt ctgtggtggt gccttctgga caggagcaga gatacacctg ccatgtgcag       780
     catgagggtc tgcccaagcc cctcaccctg agatgggagc cgtcttccca gcccaccatc       840
     cccatcgtgg gcatcattgc tggcctggtt ctctttggag ctgtgatcgc tggagctgtg       900
     gtcgctgctg tgatgtggag gaggaagagc tcagatagaa aaggagggag ctactctcag       960
     gctgcaagca gtgacagtgc ccagggctct gatatgtctc tcacagcttg taaagtgtga      1020
     gacagctgcc ttgtgtggga ctgagaggca agatttgttc ctgcccttcc ctttgtgact      1080
     tgaagaaccc tgactttgtt tctgcaaagg cacctgcatg tgtctgtgtt cttgtaggca      1140
     taatgtgagg aggtggggag accaccccac ccccatgtcc accatgaccc tcttcccacg      1200
     ctgacctgtg ctccctcccc aatcatcttt cctgttccag agaggtgggg ctgaggtgtc      1260
     tccatctctg cctcaacttc atggtgcact gagctgtaac tttttccttc cctattaaaa      1320
     ttagaacctg agtataaatt tactttctca aattcttgcc atgagaggtt gatgagttaa      1380
     ttaaaggaga agattcctaa aatttgagag acaaaataaa tggaacacat gagaaccttc      1440
     cag                                                                    1443
//


spacer
spacer