spacer

EBI Dbfetch

ID   M24043; SV 1; linear; genomic DNA; STD; HUM; 1098 BP.
XX
AC   M24043; M24029;
XX
DT   23-APR-1990 (Rel. 23, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 14)
XX
DE   Human MHC class I HLA-A1 chain gene (A1,2; B8,5), complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1098
RX   PUBMED; 2715640.
RA   Parham P., Lawlor D.A., Lomen C.E., Ennis P.D.;
RT   "Diversity and diversification of HLA-A,B,C alleles";
RL   J. Immunol. 142(11):3937-3950(1989).
XX
RN   [2]
RP   1-1098
RA   Warren E.;
RT   ;
RL   Unpublished.
XX
DR   MD5; 786691ed1151dfd95b746d3206205fae.
DR   Ensembl-Gn; ENSG00000224320; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229215; homo_sapiens.
DR   Ensembl-Tr; ENST00000431930; homo_sapiens.
DR   Ensembl-Tr; ENST00000443552; homo_sapiens.
DR   Ensembl-Tr; ENST00000549869; homo_sapiens.
DR   Ensembl-Tr; ENST00000552193; homo_sapiens.
XX
CC   Computer-readable copy of sequence [1] kindly submitted by
CC   P.D.Ennis 14-APR-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1098
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /note="MHC HLA-A1 chain"
FT                   /db_xref="GOA:P30443"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*01:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1W72"
FT                   /db_xref="PDB:3BO8"
FT                   /db_xref="PDB:4NQV"
FT                   /db_xref="PDB:4NQX"
FT                   /protein_id="AAA59652.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   old_sequence    381
FT                   /gene="HLA-A"
FT                   /citation=[1]
FT   old_sequence    558
FT                   /gene="HLA-A"
FT                   /citation=[1]
XX
SQ   Sequence 1098 BP; 221 A; 332 C; 368 G; 177 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttcttca catccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaagatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccagga gacacggaat atgaaggccc actcacagac tgaccgagcg       300
     aacctgggga ccctgcgcgg ctactacaac cagagcgagg acggttctca caccatccag       360
     ataatgtatg gctgcgacgt ggggccggac gggcgcttcc tccgcgggta ccggcaggac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcag ctcagatcac caagcgcaag tgggaggcgg tccatgcggc ggagcagcgg       540
     agagtctacc tggagggccg gtgcgtggac gggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acacatatga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagctg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ccttggagct       960
     gtgatcactg gagctgtggt cgctgccgtg atgtggagga ggaagagctc agatagaaaa      1020
     ggagggagtt acactcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//


spacer
spacer