Dbfetch

ID   M24037; SV 1; linear; unassigned DNA; STD; HUM; 1089 BP.
XX
AC   M24037; M24029;
XX
DT   23-APR-1990 (Rel. 23, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 13)
XX
DE   Human MHC class I HLA-B49 chain gene (A2.2Y,32; B40,49), complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1089
RX   PUBMED; 2715640.
RA   Parham P., Lawlor D.A., Lomen C.E., Ennis P.D.;
RT   "Diversity and diversification of HLA-A,B,C alleles";
RL   J. Immunol. 142(11):3937-3950(1989).
XX
RN   [2]
RP   1-1089
RX   DOI; 10.1007/BF00178595.
RX   PUBMED; 1518087.
RA   Imanishi T., Gojobori T.;
RT   "Patterns of nucleotide substitutions inferred from the phylogenies of the
RT   class I major histocompatibility complex genes";
RL   J. Mol. Evol. 35(3):196-204(1992).
XX
RN   [3]
RP   1-1089
RX   PUBMED; 1385528.
RA   Hildebrand W.H., Madrigal J.A., Belich M.P., Zemmour J., Ward F.E.,
RA   Williams R.C., Parham P.;
RT   "Serologic cross-reactivities poorly reflect allelic relationships in the
RT   HLA-B12 and HLA-B21 groups. Dominant epitopes of the alpha 2 helix";
RL   J. Immunol. 149(11):3563-3568(1992).
XX
DR   MD5; 34be9172c73b1953256191b7e7ba0141.
XX
CC   On Oct 12, 1993 this sequence version replaced gi:187813.
CC   Draft entry and computer-readable sequence for [1] kindly submitted
CC   by P.D.Ennis, 14-APR-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="unassigned DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1089
FT                   /partial
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /note="MHC HLA-B49 chain"
FT                   /db_xref="GOA:P30487"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*49:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30487"
FT                   /protein_id="AAA02950.1"
FT                   /translation="MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHTWQRMYGCDLGPDGRLLRGYNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 1089 BP; 225 A; 336 C; 354 G; 174 T; 0 other;
     atgcgggtca cggcaccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttccaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat caccgtgggc tacgtggacg acacgctgtt cgtgaggttc       180
     gacagcgacg ccacgagtcc gaggaaggag ccgcgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac ttaccgagag       300
     aacctgcgga tcgcgctccg ctactacaac cagagcgagg ccgggtctca cacttggcag       360
     aggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggta taaccagtta       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacatgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtccagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttga                                                              1089
//