Dbfetch

ID   M23739; SV 1; linear; mRNA; STD; HUM; 1109 BP.
XX
AC   M23739;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human major histocompatibility complex class I (HLA-A29.1) gene, complete
DE   cds.
XX
KW   class I gene; major histocompatibility complex; transplantation antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1109
RX   DOI; 10.1007/BF02341610.
RX   PUBMED; 2461903.
RA   Trapani J.A., Mizuno S., Kang S.H., Yang S.Y., Dupont B.;
RT   "Molecular mapping of a new public HLA class I epitope shared by all HLA-B
RT   and HLA-C antigens and defined by a monoclonal antibody";
RL   Immunogenetics 29(1):25-32(1989).
XX
RN   [2]
RP   1-1098
RA   Trapani J.A.;
RT   ;
RL   Submitted (04-JUL-1989) to the INSDC.
RL   Immunology, MSKCC, 1275 York Ave., New York, NY 10021, USA
XX
RN   [3]
RP   1-1098
RA   Yang S.Y.;
RT   ;
RL   Submitted (20-JAN-1997) to the INSDC.
RL   Immunology, MSKCC, 1275 York Ave., New York, NY 10021, USA
XX
DR   MD5; f9169e8798f93407d92d67f77ed8872f.
XX
CC   On Feb 21, 1997 this sequence version replaced gi:515733.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1109
FT                   /organism="Homo sapiens"
FT                   /map="chromosome 6"
FT                   /mol_type="mRNA"
FT                   /cell_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             9..1106
FT                   /codon_start=1
FT                   /product="major histocompatibility complex class I"
FT                   /note="HLA-A29.1"
FT                   /db_xref="GOA:P30512"
FT                   /db_xref="H-InvDB:HIT000194904.15"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*29:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30512"
FT                   /protein_id="AAB47873.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGT
FT                   LRGYYNQSEAGSHTIQMMYGCHVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
XX
SQ   Sequence 1109 BP; 216 A; 330 C; 376 G; 187 T; 0 other;
     cggcgaggat ggccgtcatg gcgccccgaa ccctcctcct gctactcttg ggggccctgg        60
     ccctgaccca gacctgggcg ggctcccact ccatgaggta tttcaccaca tccgtgtccc       120
     ggcccggccg cggggagccc cgcttcatcg ccgtgggcta cgtggacgac acgcagttcg       180
     tgcggtttga cagcgacgcc gcgagccaga ggatggagcc gcgggcaccg tggatagagc       240
     aggaggggcc ggagtattgg gacctgcaga cacggaatgt gaaggcccag tcacagactg       300
     accgagcgaa cctggggacc ctgcgcggct actacaacca gagcgaggcc ggttctcaca       360
     ccatccagat gatgtatggc tgccacgtgg ggtcggacgg gcgcttcctc cgcgggtacc       420
     ggcaggacgc ctacgacggc aaggattaca tcgccttgaa cgaggacctg cgctcttgga       480
     ccgcggcgga catggcggct cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg       540
     agcagttgag agcctacctg gagggcacgt gcgtggagtg gctccgcaga tacctggaga       600
     acgggaagga gacgctgcag cgcacggacg cccccaagac gcatatgact caccacgctg       660
     tctctgacca tgaggccacc ctgaggtgct gggccctgag cttctaccct gcggagatca       720
     cactgacctg gcagcgggat ggggaggacc agacccagga cacggagctt gtggagacca       780
     ggcctgcagg ggatggaacc ttccagaagt gggcgtctgt ggtggtgcct tctggacagg       840
     agcagagata cacctgccat gtgcagcatg agggtctgcc caagcccctc accctgagat       900
     gggagccgtc ttcccagccc accatcccca tcgtgggcat cattgctggc ctagttctct       960
     ttggagctgt gttcgctgga gctgtggtcg ctgctgtgag gtggaggagg aagagctcag      1020
     atagaaaagg agggagctac tctcaggctg caagcagtga cagtgcccag ggctctgata      1080
     tgtctctcac agcttgtaaa gtgtgagac                                        1109
//