spacer

EBI Dbfetch

ID   M23680; SV 1; linear; genomic DNA; STD; HUM; 249 BP.
XX
AC   M23680;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human MHC class II HLA DP-beta gene, exon 2 allele DPB5.
XX
KW   cell surface glycoprotein; class II gene; HLA-DP antigen;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-249
RX   PUBMED; 2460556.
RA   Bugawan T.L., Horn G.T., Long C.M., Mickelson E., Hansen J.A.,
RA   Ferrara G.B., Angelini G., Erlich H.A.;
RT   "Analysis of HLA-DP allelic sequence polymorphism using the in vitro
RT   enzymatic DNA amplification of DP-alpha and DP-beta loci";
RL   J. Immunol. 141(11):4024-4030(1988).
XX
DR   MD5; 3821040da12208ed011ab5fc92fcd0d7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..249
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>249
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /number=2
FT                   /note="MHC DP-beta, allele DPB5"
FT                   /db_xref="GOA:Q30040"
FT                   /db_xref="IMGT/HLA:DPB1*05:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30040"
FT                   /protein_id="AAA59745.1"
FT                   /translation="LFQGRQECYAFNGTQRFLERYIYNREELVRFDSDVGEFRAVTELG
FT                   RPEAEYWNSQKDILEEKRAVPDRMCRHNYELDEAVTLQ"
XX
SQ   Sequence 249 BP; 57 A; 61 C; 94 G; 37 T; 0 other;
     cttttccagg gacggcagga atgctacgcg tttaatggga cacagcgctt cctggagaga        60
     tacatctaca accgggagga gctcgtgcgc ttcgacagcg acgtggggga gttccgggcg       120
     gtgacggagc tggggcggcc tgaggcggag tactggaaca gccagaagga catcctggag       180
     gagaagcggg cagtgccgga caggatgtgc agacacaact acgagctgga cgaggccgtg       240
     accctgcag                                                               249
//


spacer
spacer