spacer

EBI Dbfetch

ID   M23633; SV 1; linear; mRNA; STD; INV; 1261 BP.
XX
AC   M23633;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 6)
XX
DE   D.melanogaster transformer-2 (tra-2) protein mRNA, complete cds.
XX
KW   sex-determining protein; transformer protein.
XX
OS   Drosophila melanogaster (fruit fly)
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea;
OC   Drosophilidae; Drosophila; Sophophora.
XX
RN   [1]
RP   1-1261
RX   DOI; 10.1016/0092-8674(88)90247-4.
RX   PUBMED; 3144434.
RA   Amrein H., Gorman M., Noethiger R.;
RT   "The sex-determining gene tra-2 of Drosophila encodes a putative RNA
RT   binding protein";
RL   Cell 55(6):1025-1035(1988).
XX
RN   [2]
RP   1-1261
RA   Amrein H., Gorman M., Noethiger R.;
RT   "Errata: The sex-determining gene tra-2 of Drosophila encodes a putative
RT   RNA binding protein";
RL   Cell 58:420-420(1989).
XX
DR   MD5; f47ca5e309e88895dba535ce16971592.
DR   Ensembl-Gn; FBgn0003742; drosophila_melanogaster.
DR   Ensembl-Tr; FBtr0089617; drosophila_melanogaster.
DR   Ensembl-Tr; FBtr0089620; drosophila_melanogaster.
DR   Ensembl-Tr; FBtr0089621; drosophila_melanogaster.
DR   EuropePMC; PMC2885393; 20465812.
DR   EuropePMC; PMC3068122; 21406087.
DR   FLYBASE; FBgn0003742; tra2.
XX
CC   [2]  revises [1].
CC   Draft entry and hard copy for sequence [1] kindly submitted by
CC   H.Amrein, 07-APR-1989.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1261
FT                   /organism="Drosophila melanogaster"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:7227"
FT   mRNA            <1..1261
FT                   /gene="tra2"
FT                   /note="TRA-2 mRNA"
FT   CDS             58..852
FT                   /codon_start=1
FT                   /gene="tra2"
FT                   /note="transformer-2 protein"
FT                   /db_xref="GOA:P19018"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19018"
FT                   /protein_id="AAA28953.1"
FT                   /translation="MDREPLSSGRLHCSARYKHKRSASSSSAGTTSSGHKDRRSDYDYC
FT                   GSRRHQRSSSRRRSRSRSSSESPPPEPRHRSGRSSRDRERMHKSREHPQASRCIGVFGL
FT                   NTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEV
FT                   DGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASPYDNYRDR
FT                   YDYRNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQLRRTSSRY"
XX
SQ   Sequence 1261 BP; 350 A; 332 C; 283 G; 296 T; 0 other;
     atagcaggga atcaaaccct caaaaatgcg aagtttcgat aggtaagcaa aaagccaatg        60
     gatcgggagc cactcagtag cgggcgtctc cattgcagcg ccagatataa acacaagcga       120
     tcggcgtcat catcgtcagc ggggacaact tcatccggac ataaggaccg caggtctgac       180
     tacgattact gtggcagtcg ccggcaccag cggtcctcct ctcgccgacg ctcccgttcg       240
     cgttcctcct cggagtcgcc gccaccggag ccgcgtcatc gctccggacg ttcatcacgc       300
     gatcgcgaac gaatgcacaa gtctcgcgaa catccacaag caagccgctg cataggagtc       360
     tttggactga acacaaatac ctcgcagcac aaggtacgcg agctgttcaa caagtacgga       420
     cccatcgaac gcatccagat ggtgattgac gcacaaacac agcgttcccg gggcttttgt       480
     ttcatttact ttgagaaact cagcgatgcc cgcgcggcta aggacagctg ctccggaata       540
     gaagtggatg gtcgccgtat tcgcgtcgat ttctctataa cccaacgggc tcatacccca       600
     actccgggtg tgtatttggg tcgtcagccg cgtggaaaag ctccacgctc attttcaccg       660
     cgtagaggac gccgtgtgta tcacgatcgc tccgcttcgc cctatgacaa ctatcgtgat       720
     cgctatgatt accgcaacga tcgctacgac cgtaatctcc gcaggagccc tagtcgcaac       780
     cgttacactc gcaacaggag ctacagccgt tcacgctctc cgcaactacg tcgaacttca       840
     tcgcgctatt aaagcgcctg gggaggaggc tacttcatta actcgtgctc ctaagttcgc       900
     ccaactggat tgtgtcaaac gggctgtaaa ggagcatacg actgaaatat tgtgttttgg       960
     tgaatcctat cccatctaat gcatttggtt ggcgaacagt tcgcaactag attaattaat      1020
     tattcaccca aaacaccctt taatcataat aattcggtta ctattattaa ggctgtataa      1080
     aaacataaat tgtaaatatc aaatcaatta ccaacattac atacaggtcc gcatggattg      1140
     tgatatgtat tttaaaggaa ctgcagcaaa ctgataatga taacattaaa ctaattttaa      1200
     ttataaatgc aattgtgcag caggtacaaa ataaagatta atttgtacag aagcgacgat      1260
     t                                                                      1261
//


spacer
spacer