spacer

EBI Dbfetch

ID   M22792; SV 1; linear; genomic DNA; STD; HUM; 52 BP.
XX
AC   M22792; M21035;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 13)
XX
DE   Human MHC class I HLA-B51 (C2 domain) gene, exon 7.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   HLA-B51 protein; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-52
RX   PUBMED; 2909619.
RA   Hayashi H., Ennis P.D., Ariga H., Salter R.D., Parham P., Kano K.,
RA   Takiguchi M.;
RT   "HLA-B51 and HLA-Bw52 differ by only two amino acids which are in the
RT   helical region of the alpha 1 domain";
RL   J. Immunol. 142(1):306-311(1989).
XX
DR   MD5; e6e2034da1512732f23a639214b60d1e.
DR   Ensembl-Gn; ENSG00000206450; homo_sapiens.
DR   Ensembl-Tr; ENST00000359635; homo_sapiens.
XX
CC   Draft entry and computer-readable sequence [1] kindly submitted by
CC   P.Ennis, 14-OCT-1988.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..52
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(M22786.1:1..73,M22787.1:1..270,M22788.1:1..276,
FT                   M22789.1:1..276,M22790.1:1..117,M22791.1:1..33,1..51)
FT                   /partial
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /note="MHC HLA-B51"
FT                   /db_xref="GOA:P18464"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*51:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1E27"
FT                   /db_xref="PDB:1E28"
FT                   /db_xref="PDB:4MJI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18464"
FT                   /protein_id="AAA59620.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAACGKPATVPRALMCLSQL"
FT   exon            1..51
FT                   /gene="HLA-B"
FT                   /note="MHC HLA-B51, exon 7; putative"
FT   exon            1..>52
FT                   /gene="HLA-B"
FT                   /number=7
FT                   /note="MHC HLA-B51; G00-120-048"
XX
SQ   Sequence 52 BP; 12 A; 14 C; 15 G; 11 T; 0 other;
     gtggaaaacc agcgacagtg cccagggctc tgatgtgtct ctcacagctt ga                52
//


spacer
spacer