spacer

EBI Dbfetch

ID   M21886; SV 1; linear; mRNA; STD; HUM; 690 BP.
XX
AC   M21886;
XX
DT   22-APR-1989 (Rel. 19, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human MHC class II HLA-DPw4b-beta chain mRNA (DPw4), 3' end.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-690
RX   PUBMED; 2456351.
RA   Lair B., Alber C., Yu W.Y., Watts R., Bahl M., Karr R.W.;
RT   "A newly characterized HLA-DP beta-chain allele. Evidence for DP beta
RT   heterogeneity within the DPw4 specificity";
RL   J. Immunol. 141(4):1353-1357(1988).
XX
DR   MD5; 383ed1cdd32ff9f086e95f227d184a05.
DR   H-InvDB; HIT000194810_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..690
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   mat_peptide     <1..687
FT                   /gene="HLA-DPB1"
FT                   /note="MHC HLA-DPw4b-beta chain"
FT   CDS             <1..690
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /note="MHC HLA-DPw4b-beta chain precursor"
FT                   /db_xref="GOA:Q30030"
FT                   /db_xref="H-InvDB:HIT000194810_02.4"
FT                   /db_xref="IMGT/HLA:DPB1*04:02:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30030"
FT                   /protein_id="AAA59739.1"
FT                   /translation="RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEF
FT                   RAVTELGRPDEEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKK
FT                   GPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTP
FT                   QQGDVYTCQVEHTSMDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIICGVGIFMHRRSK
FT                   KVQRGSA"
XX
SQ   Sequence 690 BP; 163 A; 177 C; 223 G; 127 T; 0 other;
     agggccactc cagagaatta ccttttccag ggacggcagg aatgctacgc gtttaatggg        60
     acacagcgct tcctggagag atacatctac aaccgggagg agttcgtgcg cttcgacagc       120
     gacgtggggg agttccgggc ggtgacggag ctggggcggc ctgatgagga gtactggaac       180
     agccagaagg acatcctgga ggagaagcgg gcagtgccgg acaggatgtg cagacacaac       240
     tacgagctgg gcgggcccat gaccctgcag cgccgagtcc agcctagggt gaatgtttcc       300
     ccctccaaga aggggccctt gcagcaccac aacctgcttg tctgccacgt gacggatttc       360
     tacccaggca gcattcaagt ccgatggttc ctgaatggac aggaggaaac agctggggtc       420
     gtgtccacca acctgatccg taatggagac tggaccttcc agatcctggt gatgctggaa       480
     atgacccccc agcagggaga tgtctacacc tgccaagtgg agcacaccag catggatagt       540
     cctgtcaccg tggagtggaa ggcacagtct gattctgccc ggagtaagac attgacggga       600
     gctgggggct tcgtgctggg gctcatcatc tgtggagtgg gcatcttcat gcacaggagg       660
     agcaagaaag ttcaacgagg atctgcataa                                        690
//


spacer
spacer