Dbfetch

ID   M21533; SV 1; linear; genomic DNA; STD; HUM; 4938 BP.
XX
AC   M21533;
XX
DT   22-APR-1989 (Rel. 19, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human MHC class I lymphocyte antigen (HLA-E) (HLA-6.2) gene, complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; lymphocyte antigen;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4938
RX   PUBMED; 3260916.
RA   Koller B.H., Geraghty D.E., Shimizu Y., DeMars R., Orr H.T.;
RT   "HLA-E. A novel HLA class I gene expressed in resting T lymphocytes";
RL   J. Immunol. 141(3):897-904(1988).
XX
DR   MD5; da0cbdab9aa18131a92d194b667bc168.
DR   Ensembl-Gn; ENSG00000206493; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229252; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230254; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233904; homo_sapiens.
DR   Ensembl-Tr; ENST00000383597; homo_sapiens.
DR   Ensembl-Tr; ENST00000415289; homo_sapiens.
DR   Ensembl-Tr; ENST00000415649; homo_sapiens.
DR   Ensembl-Tr; ENST00000427936; homo_sapiens.
DR   EuropePMC; PMC28094; 9861020.
XX
CC   Draft entry and computer-readable sequence [1] kindly submitted by
CC   H.T.Orr, 23-NOV-1988.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4938
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     704..768
FT                   /note="MHC HLA-E signal peptide"
FT   CDS             join(705..768,899..1168,1411..1686,2308..2583,2708..2824,
FT                   3575..3607,3712..3752)
FT                   /partial
FT                   /codon_start=1
FT                   /note="MHC HLA-E precursor"
FT                   /db_xref="GOA:P13747"
FT                   /db_xref="HGNC:HGNC:4962"
FT                   /db_xref="IMGT/HLA:E*01:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1KPR"
FT                   /db_xref="PDB:1KTL"
FT                   /db_xref="PDB:1MHE"
FT                   /db_xref="PDB:2ESV"
FT                   /db_xref="PDB:3AM8"
FT                   /db_xref="PDB:3BZE"
FT                   /db_xref="PDB:3BZF"
FT                   /db_xref="PDB:3CDG"
FT                   /db_xref="PDB:3CII"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13747"
FT                   /protein_id="AAA59835.1"
FT                   /translation="MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFIS
FT                   VGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRR
FT                   YYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQI
FT                   SEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATL
FT                   RCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCH
FT                   VQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGS
FT                   YSKAEWSDSAQGSESHSL"
FT   prim_transcript <705..4479
FT                   /note="MHC HLA-E mRNA and introns"
FT   exon            <705..768
FT                   /gene="HLA-E"
FT                   /number=1
FT                   /note="MHC HLA-E precursor; G00-120-050"
FT   intron          769..898
FT                   /note="MHC HLA-E, intron A"
FT   mat_peptide     899..1168
FT                   /note="MHC HLA-E"
FT   exon            899..1168
FT                   /number=2
FT   intron          1169..1410
FT                   /note="MHC HLA-E, intron B"
FT   mat_peptide     1411..1686
FT                   /note="MHC HLA-E"
FT   exon            1411..1686
FT                   /number=3
FT   intron          1687..2307
FT                   /note="MHC HLA-E, intron C"
FT   mat_peptide     2308..2583
FT                   /note="MHC HLA-E"
FT   exon            2308..2583
FT                   /number=4
FT   intron          2584..2707
FT                   /note="MHC HLA-E, intron D"
FT   exon            2708..2824
FT                   /number=5
FT   mat_peptide     2708..2825
FT                   /note="MHC HLA-E"
FT   intron          2825..3574
FT                   /note="MHC HLA-E, intron E"
FT   exon            3575..3607
FT                   /number=6
FT   mat_peptide     3576..3607
FT                   /note="MHC HLA-E"
FT   intron          3608..3711
FT                   /note="MHC HLA-E, intron F"
FT   exon            3712..>3752
FT                   /number=7
FT                   /note="MHC HLA-E precursor"
FT   mat_peptide     3712..3749
FT                   /note="MHC HLA-E"
FT   intron          3755..3919
FT                   /note="MHC HLA-E, intron G"
XX
SQ   Sequence 4938 BP; 1065 A; 1332 C; 1380 G; 1161 T; 0 other;
     ggcatgatgg acgcgattag ccggtaacgg atacatgaag catgaggtct ttgaagtcat        60
     tggcggctct ctggtgtacg agtctcagct ggttgactac aaggcactct gaagcagatc       120
     ctgttttttg ttttgttttg ttttttgttc tgtttttccc cctagacatc tcactctgct       180
     gcccaggctg gagtgcagtg gtgtgatctc ggctcactgc aaccatccat cctcctgggt       240
     tcaagtagat tctccatgcc tcagcctccc aagtagccag gattacagcc atgcgccacc       300
     acgccggcta attttttgga cttttagtag agacagggtt tctccatatt ggtcgggctg       360
     gtctcgaact cccaacctca ggtgatcagc ccgccttggc ctcccaaagt gctgagatta       420
     caggcgtgag ccaccgcgcc cagccaggac taatttctaa gagtgtgcag agataccgaa       480
     acctaaaagt ttaagaactg ctgattgctg ggaaactctg cagtttcccg ttcctctcgt       540
     aacctggtca tgtgtccttc ttcctggata ctcatgacgc agactcagtt ctcattccca       600
     atgggtgtcg ggtttctaga gaagccaatc agcgtcgcca cgactcccga ctataaagtc       660
     cccatccgga ctcaagaagt tctcaggact cagaggctgg gatcatggta gatggaaccc       720
     tccttttact cctctcggag gccctggccc ttacccagac ctgggcgggt gagtgcgggg       780
     tcgggatgga aacggcctct accgggagta gagaggggcc ggcccggcgg gggcgaagga       840
     ctcggggagc cgcgccggga ggagggtcgg gccgatctca gcccctcctc gcccccaggc       900
     tcccactcct tgaagtattt ccacacttcc gtgtcccggc ccggccgcgg ggagccccgc       960
     ttcatctctg tgggctacgt ggacgacacc cagttcgtgc gcttcgacaa cgacgccgcg      1020
     agtccgagga tggtgccgcg ggcgccgtgg atggagcagg aggggtcaga gtattgggac      1080
     cgggagacac ggagcgccag ggacaccgca cagattttcc gagtgaacct gcggacgctg      1140
     cggcgctact acaatcagag cgaggccggt gagtgacccc ggccaggagc aggtcacgac      1200
     ccctccccat cccccacgga cggcgcgggt cccctcgaat cttcgggtcc cagattcacc      1260
     ccaaggctgc ggaacccgcc cagaccctag accggggaga gtctcaggcg cctttacccg      1320
     gttctttttc agtttaggcc aaaatgccca cagggtggtg gcgacggggg cggggcttgg      1380
     tgggcgggac tgactaaggg gcggggccag ggtctcacac cctgcagtgg atgcatggct      1440
     gcgagctggg gcccgacagg cgcttcctcc gcgggtatga acagttcgcc tacgacggca      1500
     aggattatct caccctgaat gaggacctgc gctcctggac cgcggtggac acggcggctc      1560
     agatctccga gcaaaagtca aatgatgcct ctgaggcgga gcaccagaga gcctacctgg      1620
     aagacacatg cgtggagtgg ctccacaaat acctggagaa ggggaaggag acgctgcttc      1680
     acctgggtaa gagggtccac agggctactc tcccatctcc ttcttgggct aggactgtgc      1740
     ccacagctga cagacctcaa acagtagaag aaacagggat ggaggccaga ataccactcc      1800
     tcccttggat caggagaggg agctgtcacc tgaggtacag gagatcctat accacagagt      1860
     gactctctta aagggccaga cctctctcag gggcaattaa ggaatctagt ctcgctggag      1920
     attccatcct tcagatgaac tgatgagcag ttctctttga ctcccagtat taggaatcac      1980
     gggggagttt ctctcgtgcc tgattctcag ccccacacca agagtttttg gaggtctgac      2040
     tccagctttt ctcagtcact cagcatccac acaggccagg accagaaatc ccttttcacc      2100
     ttctaccctg ggctagctca tcccgattct agaactttcc aaggaataag aggctatccc      2160
     agatccctaa gtccaggctg gtgtcaaggt tttgtcctct tctcctacta taattgtcct      2220
     cttccttctc aggatggtca catgggtgct gctggagtgt cccatgagag atacaaagtg      2280
     cctgaatttt ctgactcttc ccctcagagc ccccaaagac acacgtgact caccacccca      2340
     tctctgacca tgaggccacc ctgaggtgct gggccctggg cttctaccct gcggagatca      2400
     cactgacctg gcagcaggat ggggagggcc atacccagga cacggagctc gtggagacca      2460
     ggcctgcagg ggatggaacc ttccagaagt gggcagctgt ggtggtgcct tctggagagg      2520
     agcagagata cacgtgccat gtgcagcatg aggggctacc cgagcccgtc accctgagat      2580
     ggagtaagga gggggatggg aggtcatgtc tcttctcagg gaaagcggga gcccttctgg      2640
     agcccttccg cagggtcagg gctgaggcct gggggtcagg gccccttacg ttcccctctt      2700
     ttcccagagc cggcttccca gcccaccatc cccatcgtgg gcatcattgc tggcctggtt      2760
     ctccttggat ctgtggtctc tggagctgtg gttgctgctg tgatatggag gaagaagagc      2820
     tcaggtgggg aagggagaag ggtggggtct gagttttctt gtcccactgg gtgtttcaag      2880
     ccctaggtaa aagtgtgtcc tgcctcgtta ctgggaagca ccatccacac acacgagcct      2940
     acccagcctg gggccctgtg tgccagcacc tactcttttt ttttgagacg gagtcttggc      3000
     tctgtcaccc aggctggagt gcaatggcgt ggtttcagct cactgcaacc tccgcctccc      3060
     aggttcaagc aattctcctg cctcagcctc cctagtagct gggactacac atgcgtgcca      3120
     ccacacctgg ctaatttttt tttttgtatt tttagtggag atggggtttc actatgttgg      3180
     ccaggctggt ctcgaactcc tgactttgtg atctgcctgc ctcggcctcc caaagtgctg      3240
     ggattacagt cgtgagccac cgcacccagc cgcacctact cttttgtaaa gcacctgtga      3300
     caatgaagga cagatttatc accttgacga ttgtggtgat ggggacctga tcccagcagt      3360
     cacaggtcac aggggaaggt ccctgctgaa gacagacctc agaagggcag ttgatccagg      3420
     acccacacct gctttcttca cgtttcctga tcctgccctg ggtctgcagt cacagttcag      3480
     gaaacttctc tgggatccaa aactaggagg ttcctctagg accttatggc cctgcctcct      3540
     ccctggcccc tcacaggaca ttttcttcca acaggtggaa aaggagggag ctactctaag      3600
     gctgagtgta agtgcggggc gggagcgtgg aggagctcgc ccaccctata attcctcctg      3660
     caccacatct cctgtgggct ctgaccaggt cttgtttttg ttctacccca gggagcgaca      3720
     gtgcccaggg gtctgagtct cacagcttgt aaaggtgaga ttctgggggt ctgaagtggg      3780
     tggagggtgg ggcagagggg acaggactgg gttgtgggga ttttttgatt cagaattttt      3840
     gagtgtgtgg tgggctgttc agagtgtcat cacttaccgt gactgacctg aatttgttca      3900
     tgactatttt cttctgtagc ctgagacagc tgccttgtgt gcgactgaga tgcacagctg      3960
     ccttgtgtgc gactgagatg caggatttcc tcacgcctcc cctatgtgtc ttaggggact      4020
     ctggcttctc tttttgcaag ggcctctgaa tctgtctgtg tccctgttag cacaatgtga      4080
     ggaggtagag aaacagtcca cctctgtgtc taccatgacc cccttcctca cactgacctg      4140
     tgttccttcc ctgttctctt ttctattaaa aataagaacc tgggcagagt gcggcagctc      4200
     atgcctgtaa tcccagcact tagggaggcc gaggagggca gatcacgagg tcaggagatc      4260
     gaaaccatcc tggctaacac ggtgaaaccc cgtctctact aaaaaataca aaaaattagc      4320
     tgggcgcaga ggcacgggcc tgtagtccca gctactcagg aggcggaggc aggagaatgg      4380
     cgtcaacccg ggaggcggag gttgcagtga gccaggattg tgcgactgca ctccagcctg      4440
     ggtgacaggg tgaaacgcca tctcaaaaaa taaaaattaa aaaataaaaa aagaacctgg      4500
     atctcaattt aatttttcat attcttgcaa tgaaatggac ttgaggaagc taagatcata      4560
     gctagaaata cagataattc cacagcacat ctctagcaaa tttagcctat tcctattctc      4620
     tagcctattc cttaccacct gtaatcttga ccatatacct tggagttgaa tattgttttc      4680
     atactgctgt ggtttgaatg ttccctccaa cactcatgtt gagacttaat ccctaatgtg      4740
     gcaatactga aaggtggggc ctttgagatg tgattggatc gtaaggctgt gccttcattc      4800
     atgggttaat ggattaatgg gttatcacag gaatgggact ggtggcttta taagaagagg      4860
     aaaagagaac tgagctagca tgcccagccc acagagagcc tccactagag tgatgctaag      4920
     tggaaatgtg aggtgcag                                                    4938
//