spacer

EBI Dbfetch

ID   M20555; SV 1; linear; genomic DNA; STD; HUM; 6194 BP.
XX
AC   M20555; M19556;
XX
DT   20-FEB-1989 (Rel. 18, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 15)
XX
DE   Human MHC class II HLA-DRw53-beta (DR4,w4) gene, exons 2,3,4,5,6.
XX
KW   Alu repeat; cell surface glycoprotein; class II gene;
KW   complement system protein; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-6194
RX   PUBMED; 3036826.
RA   Andersson G., Larhammar D., Widmark E., Servenius B., Peterson P.A.,
RA   Rask L.;
RT   "Class II genes of the human major histocompatibility complex. Organization
RT   and evolutionary relationship of the DR beta genes";
RL   J Biol Chem 262(18):8748-8758(1987).
XX
DR   MD5; a9df63441f7ad2214e72f00d28e23163.
DR   Ensembl-Gn; ENSG00000227357; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231021; homo_sapiens.
DR   Ensembl-Tr; ENST00000411565; homo_sapiens.
DR   Ensembl-Tr; ENST00000457451; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6194
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            878..1147
FT                   /gene="HLA-DRB4"
FT                   /note="MHC DRw53-beta, exon 2 (AA at 880); G00-120-645;
FT                   putative"
FT   CDS             join(878..1147,3888..4169,4873..4983,5458..5481,5783..5796)
FT                   /partial
FT                   /codon_start=3
FT                   /gene="HLA-DRB4"
FT                   /note="MHC DRw53-beta (AA at 880)"
FT                   /db_xref="GOA:P13762"
FT                   /db_xref="HGNC:HGNC:4952"
FT                   /db_xref="IMGT/HLA:DRB4*01:03:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13762"
FT                   /protein_id="AAA59830.1"
FT                   /translation="RFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPL
FT                   QHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGH
FT                   SGLQPTGLLS"
FT   exon            <878..1147
FT                   /gene="HLA-DRB4"
FT                   /number=2
FT                   /note="MHC DRw53-beta; G00-120-645"
FT   intron          1148..3887
FT                   /gene="HLA-DRB4"
FT                   /note="MHC DRw53-beta intron A; G00-120-645"
FT   repeat_region   1302..1796
FT                   /gene="HLA-DRB4"
FT                   /note="Alu repeat; G00-120-645"
FT   repeat_region   1302..1307
FT                   /gene="HLA-DRB4"
FT                   /note="Alu 5' direct repeat; G00-120-645"
FT   repeat_region   1791..1796
FT                   /gene="HLA-DRB4"
FT                   /note="Alu 3' direct repeat; G00-120-645"
FT   exon            3888..4169
FT                   /gene="HLA-DRB4"
FT                   /note="MHC DRw53-beta, exon 3; G00-120-645; putative"
FT   exon            <3888..4169
FT                   /gene="HLA-DRB4"
FT                   /number=3
FT                   /note="MHC DRw53-beta; G00-120-645"
FT   intron          4170..4872
FT                   /gene="HLA-DRB4"
FT                   /note="MHC DRw53-beta intron B; G00-120-645"
FT   exon            4873..4983
FT                   /gene="HLA-DRB4"
FT                   /note="MHC DRw53-beta, exon 4; G00-120-645; putative"
FT   exon            <4873..4983
FT                   /gene="HLA-DRB4"
FT                   /number=4
FT                   /note="MHC DRw53-beta; G00-120-645"
FT   intron          4984..5457
FT                   /gene="HLA-DRB4"
FT                   /note="MHC DRw53-beta intron C; G00-120-645"
FT   exon            5458..>5481
FT                   /gene="HLA-DRB4"
FT                   /number=5
FT                   /note="MHC DRw53-beta; G00-120-645"
FT   exon            5458..5481
FT                   /gene="HLA-DRB4"
FT                   /note="MHC DRw53-beta, exon 5; G00-120-645; putative"
FT   intron          5482..5782
FT                   /gene="HLA-DRB4"
FT                   /note="MHC DRw53-beta intron D; G00-120-645"
FT   exon            5783..>5796
FT                   /gene="HLA-DRB4"
FT                   /number=6
FT                   /note="MHC DRw53-beta; G00-120-645"
FT   exon            5783..5796
FT                   /gene="HLA-DRB4"
FT                   /note="MHC DRw53-beta, exon 6; G00-120-645; putative"
XX
SQ   Sequence 6194 BP; 1556 A; 1328 C; 1488 G; 1816 T; 6 other;
     ttgggtctcc agcctaatct tttaccttcc ttccctnagc ctctctgctt tagtgaactt        60
     tgttctagtt ttttgaagaa gctcatcaat tcaacctttt gtacatggga tttcctaaac       120
     ctgaaatgtg cctcccgttt tgtccagaca gacacacagg ctccatccac tctgccccct       180
     ggctctcacc tgcttaacct gtcaagtcac atctgaactg tcactcttca gagggtcctt       240
     ctctggcacc ctaatgtaat tgagatcatc cttttattct ctgttccaga actccacact       300
     tctgacgttt ctcattcctg tctaagctct tgtgtgtttg gtttttggcc atcacgttca       360
     ctgctcttta agctccccca gcggagtgga gaggtctgtt tcctttgttt ggattcctag       420
     aggcagcgca gaccaggcac aaggtcagca ctaaggaagg gttcacggga tgaacacggt       480
     gggtgctgtt gaaggaaccg gtaaagcgtg tgggatgaga ggagcagaga gtgtctttca       540
     ggtgaagact cccagaagga ggccgcgtgg gccgcggtgc tgggcggatc ctcctccagc       600
     tcctgcctgg agttctccag aacaggctgg aggcagggag ggggtcccca aaagcctgag       660
     gatcagaagg ggttttcccg cctggtcccc cagaccccgg ttcgcctcag gaagactgag       720
     gacgagcccc tgggctgctg gtggtggggc gttgcgggtg gggccggtta aggttcccag       780
     cgcccgcacc ccgcccaggg agtccgggtt ggtggcgtcg ctgtcagtgt cttctcagga       840
     ggccgcccgt gtgaccggat cgttcgtgtc cccacagcac gtttcttgga gcaggctaag       900
     tgtgagtgtc atttcctcaa tgggacggag cgagtgtgga acctgatcag atacatctat       960
     aaccaagagg agtacgcgcg ctacaacagt gacctggggg agtaccaggc ggtgacggag      1020
     ctggggcggc ctgacgctga gtactggaac agccagaagg acctcctgga gcggaggcgg      1080
     gccgaggtgg acacctactg cagatacaac tacggggttg tggagagctt cacagtgcag      1140
     cggcgaggtg agcatggtgg agggcggggc ctgggtccct gtgagcgggg aatctgtgta      1200
     tgtgtgtgtg tgtgtgtgtg tgtcagagag agagagagag agagagagac agaggaagag      1260
     agagagagcg tgcgccatct ctgagcattt agaatcctct ctatcctttc ttatggctgc      1320
     gtagtattcc ctggtgtata ggtgccacat tgtcttaatc cagtctatca ttgatggaca      1380
     ttagggttaa ttccaagtct ttgctattgt gaatagtgtc agttcatgtc ctttgtaggg      1440
     acatggatgc agctggaaac catcattctc agcaaactat cacaaggaca gaaaaccaaa      1500
     caccacttgt tctcactcat aggtgggaat tgaacaatga gaacacatgg acacaggaag      1560
     gggaacatca cacacagggg cctgtcgtgg ggtgggggag cagggagtga tagcattagg      1620
     agatatacct aatgtaaatg actagttaat gggtgcagca taccaacatg acacatgtgt      1680
     acatatgtaa caaacctgca cgttgtgcac atgtatccta gaacttaaag tataataata      1740
     ataattatat atatatatat attagaaaaa caaacaaaaa gaatcttctc tatcctgagc      1800
     aaggagttct gaaggcacag gtgtgtgtag agtgtggatt tgtctgtgtg gctgttgtgg      1860
     gaggggaaac aggagggggc tgcttcttat tcttggaggc ctctgtgcag aggtgacatg      1920
     ggaggtgggt gtagggggct ggagagagag gagaccttga ttgtcctggg tccttagaga      1980
     tgcagggaag ggaagaataa ggtgtgtgtg gttggggtga aggtttaggg gaggagagct      2040
     gaggagtgtg gaaggtttgg gataatgtga ggaggccagt tccagactgt ccctggcaca      2100
     cacccttcat gtaatctctg aaataaaagt gtgtgctgtt tgtttgtaaa agcattagat      2160
     taatttctag gggaattgag gagacctctg aggcacctct gaagcttctt taggtctaaa      2220
     tttcttgcta gtttttgttt ttttagggtg tatattttta catagacaga agtgactgtg      2280
     aaactaactt tttgaattaa agttttaaca cagttactat tttattataa tgctaatagt      2340
     tttctagtag ttacatctta ttcttttgta tataatagtt gtgacacaac ttacctcact      2400
     ttcccctttt tgttgacctt tattatgact ttcaccaaaa gttgaaaatg tatgtttctg      2460
     gttaattttt actttatatt tttcatttgt aattcttttg aattattttg acctatttat      2520
     tggccaatta taattactgc tgtaagaatt ccctatttca tttggtaggg aatgtacaat      2580
     gatctactgt ctaatatctt aagggcttag tatttttctc agtgactttg tgggttcttt      2640
     gtactgtaag attattaaca ctttattgat atttgattca gcattttctc cagtttgtgg      2700
     tttgtatgtg gattttgaaa agtattttcc atgttaagaa tttgaacatt tttatttaat      2760
     aaaatatatt gcgaaatttg tattaatgat ttacaatcat cttaaatcca ccattttgtg      2820
     gtattgttgt ctccaggttt ctccttcctt ctaaaaaaaa actgtattta ttgagagtat      2880
     gctagtgtca gggattttcc tgggcataag caccccaagt gacgagtccc agacactgcc      2940
     ttaatccaaa tgtcattctg gaaagaaaaa tcattttaca atgataggcc taataataat      3000
     taagcttgtg ttgcacagga gatacattga tcagctaaat gtaaacgtaa gaactttcaa      3060
     aactaaaatg acattcctta atcattctct ctgcgttagg actcatgctt tcttaggaac      3120
     ttaaagattt ggagaatcat ttctgtctgt cccaccttcc caggggcaga accatttctg      3180
     tggtgttcta aggtgtgagt gcatggtggt agtattccca aaaattcata ctcggtttcc      3240
     tcatgtaccc aactctgtcc ctttatctac ccacattgct ttaagtcata tttttctgtc      3300
     acggtgtaca aggatgataa ataggtgcca agtggagcac ccaagtgtga tgagccccct      3360
     cacagtggaa tggagtgaca agctttctaa cctcataaat tgaaggctat cttcagtcat      3420
     tgttttatat attttacgtg cattaatcct catataaccc caagaggtaa attagtataa      3480
     ttatccttca ttgtaggtga caaagttgag acacagaaga atcaaaaaac tcttccagca      3540
     tcaaccagta aaaggcagac cttggatttc aaccaggcaa catggctcag atatcagttt      3600
     taattactac actctactgt caaagatttg taaacacttt gacaatgcat gccaatttca      3660
     agctatgaag aaacaaacac aatttttcac aacatctctc aaatctaatg ggtcctcact      3720
     atcaagatta aattccaggc tgatgacact gtaaggccac atggccagct gtgctggagg      3780
     cctggtcaag gtcagagcct gggtttgcag agaagcagac aaacagccaa acaaggagac      3840
     ttactctgtc ttcatgactc attcccacta cctttttttt ctcctagtcc aacctaaggt      3900
     gactgtgtat ccttcaaaga cccagcccct gcagcaccac aacctcctgg tctgctctgt      3960
     gaatggtttc tatccaggca gcattgaagt caggtggttc cggaacggcc aggaagagaa      4020
     ggctggggtg gtgtccacag gcctgatcca gaatggagac tggaccttcc agaccctggt      4080
     gatgctggaa acagttcctc ggagtggaga ggtttacacc tgccaagtgg agcatccaag      4140
     catgatgagc cctctcacgg tgcaatggag ttagcagctt tctgacttcc taaatttctc      4200
     acccaccaag aaggggactg tgctaatccc tgagtgtcag gtttctcctc tcccacatcc      4260
     tattttcatt tgctccatgt tctcatctcc atcagcacag gtcactgggc tactgggggt      4320
     agccctgtag gtgtttctag aaacacctgt accccctggg gaatcagtca cgcctgccag      4380
     gcgggagagg ctgtccctct tttgaacctc cccatgatgt cccagttcag ggtcacccac      4440
     tctccccagg ctccaggccc tgcctctggg tctgagactg cgtttctggt gctgttgatc      4500
     tgagttgttt gttgtgagaa gaggagaact ctaggggcct tcctgacatg aggggagtcc      4560
     aatctcaact ctgcctttta ttagctctgt cactctagac aaactactta acctcactga      4620
     gactcaggct ttctgttgat cagattttga agttgcgcct tacatcaagg ctgtaatatt      4680
     tgaaatgagt ttgatgcctg gaccttgtaa ctgttacagt gtgatttgaa aaccgttttt      4740
     tcccccagaa atggctagtt attttagttc ttacagggca gccttctttc ccattttgaa      4800
     agctctgaac ttagggtctc aattacagag gttcaatttg gaataaacac taaacctggc      4860
     ttcctctctc aggtgcacgg tctgaatctg cacagagcaa gatgctgagt ggagtcgggg      4920
     gctttgtgct gggcctgctc ttccttggga cagggctgtt catctacttc aggaatcaga      4980
     aaggtgagga gcttttggga gctgaatctc cataggcttt tctggaggag gaactatgac      5040
     tttgctaggg ttagttctca gtatatcagt ggccctngat aaagcctttc tttccccaaa      5100
     tgacctccaa tgtcctgata atccagaaat catcagtgca tggttactat gtcaaagcat      5160
     aatagcttgt ggcctgcaga gataagagaa aggttaacaa gtagggattc tttggttgga      5220
     gatcctggag caaattaagg aagagccact aaggctaatg caattacgct ggatcctgtg      5280
     acagacacct catgcttcat gggtcacatg gtctgtttct gttcctctct gccctggttg      5340
     gtgtgggttg tggtgttaga gaaatctcag gtgggagatc tggggctggg acattgtgtt      5400
     agaagacaga tttgcttcca tatcttttaa gtgtatatct tttcctcttt ttcccaggac      5460
     actctggact tcagccaaca ggtaatacct tttaatcctc tttcagaaag agattcagtt      5520
     tccctngaat gatggcagag gtgataaggc atgagacaga aataatagga aagactttgg      5580
     atccagattt ctgatcaggc aatttacccc agaactcctc ctctccactt agaaaaggcc      5640
     tgtgctttgc aggatcattg gctcagggag acttaggaac ttgtttttct tctccctgca      5700
     gtgctctcat ctgagtcgtg aaagcgggga aaagaagttt tagtaaagcc aggtctgaaa      5760
     acaatttcct ctgtctctgc aggactcttg agctgaagtg cagatgacca cattcaagga      5820
     agaacctctt gccccagctt tgcaagatga aagctttccc acntggctct tattcttcca      5880
     caagagcttt gtcaggacna ggacnaggtt gttactggtt cagcaactct gcagaaaatg      5940
     tcctcccttg tggcttcctt agctcctgtt cctggcctga agcctcacag ctttgatggc      6000
     agtgcctcat cttcaacttt tgtgcttccc tttacctaaa ctgtctgcct cccgtgcatc      6060
     tgtactcccc ttgtgccaca cattgcatta ttaaatgttt ctcaacatgg agttaaaaat      6120
     tatctggtcc atttggccgc aaggacaaaa aataagaaaa agggaagatt atttcccaaa      6180
     tagaataatg gttt                                                        6194
//


spacer
spacer