spacer

EBI Dbfetch

ID   M20430; SV 1; linear; mRNA; STD; HUM; 1158 BP.
XX
AC   M20430;
XX
DT   20-FEB-1989 (Rel. 18, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Human MHC class II HLA-DR-beta (DR2-DQw1/DR4 DQw3) mRNA, complete cds,
DE   clone ROF-beta-2b.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1158
RX   DOI; 10.1007/BF00364432.
RX   PUBMED; 3259543.
RA   Lock C.B., So A.K., Welsh K.I., Parkes J.D., Trowsdale J.;
RT   "MHC class II sequences of an HLA-DR2 narcoleptic";
RL   Immunogenetics 27(6):449-455(1988).
XX
DR   MD5; c5f3d02657c91c8591c2efc416e5e5ff.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   EuropePMC; PMC1764410; 17173685.
DR   EuropePMC; PMC1796541; 17239251.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1158
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..1158
FT                   /gene="HLA-DRB1"
FT                   /note="MHC HLA-DRB mRNA; G00-120-642"
FT   sig_peptide     44..130
FT                   /gene="HLA-DRB1"
FT                   /note="MHC HLA-DR-beta chain signal peptide; G00-120-642"
FT   CDS             44..844
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /note="MHC HLA-DR-beta chain precursor old gene name
FT                   'HLA-DRA1'"
FT                   /db_xref="GOA:P01911"
FT                   /db_xref="H-InvDB:HIT000194726.14"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*15:01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1BX2"
FT                   /db_xref="PDB:1YMM"
FT                   /db_xref="PDB:2WBJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01911"
FT                   /protein_id="AAA59831.1"
FT                   /translation="MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECH
FT                   FFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAV
FT                   DTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLN
FT                   GQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
FT   mat_peptide     131..841
FT                   /gene="HLA-DRB1"
FT                   /note="MHC HLA-DR-beta chain; G00-120-642"
XX
SQ   Sequence 1158 BP; 243 A; 313 C; 331 G; 271 T; 0 other;
     cttgcctgct tctctggccc ctggtcctgt cctgttctcc agcatggtgt gtctgaagct        60
     ccctggaggc tcctgcatga cagcgctgac agtgacactg atggtgctga gctccccact       120
     ggctttgtct ggggacaccc gaccacgttt cctgtggcag cctaagaggg agtgtcattt       180
     cttcaatggg acggagcggg tgcggttcct ggacagatac ttctataacc aggaggagtc       240
     cgtgcgcttc gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctga       300
     cgctgagtac tggaacagcc agaaggacat cctggagcag gcgcgggccg cggtggacac       360
     ctactgcaga cacaactacg gggttgtgga gagcttcaca gtgcagcggc gagtccaacc       420
     taaggtgact gtatatcctt caaagaccca gcccctgcag caccacaacc tcctggtctg       480
     ctctgtgagt ggtttctatc caggcagcat tgaagtcagg tggttcctga acggccagga       540
     agagaaggct gggatggtgt ccacaggcct gatccagaat ggagactgga ccttccagac       600
     cctggtgatg ctggaaacag ttcctcgaag tggagaggtt tacacctgcc aagtggagca       660
     cccaagcgtg acaagccctc tcacagtgga atggagagca cggtctgaat ctgcacagag       720
     caagatgctg agtggagtcg ggggctttgt gctgggcctg ctcttccttg gggccgggct       780
     gttcatctac ttcaggaatc agaaaggaca ctctggactt cagccaacag gattcctgag       840
     ctgaaatgca gatgaccaca ttcaaggaag aactttctgc cccggctttg caggatgaaa       900
     gctttcctgc ttggcagtta ttcttccaca agagagggct ttctcaggac ctggttgcta       960
     ctggttcggc aactgcagaa aatgtcctcc cttgtggctt cctcagctcc tgcccttggc      1020
     ctgaagtccc agcattgatg gcagcgcctc atcttcaact tttgtgctcc cctttgccta      1080
     aaccgtatgg cctcccgtgc atctgtattc accctgtatg acaaacacat tacattatta      1140
     aatgtttctc aaagatgg                                                    1158
//


spacer
spacer