Dbfetch

ID   M20022; SV 1; linear; mRNA; STD; HUM; 1665 BP.
XX
AC   M20022;
XX
DT   20-FEB-1989 (Rel. 18, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Human HLA-E class I mRNA.
XX
KW   class I gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1665
RX   PUBMED; 3131426.
RA   Mizuno S., Trapani J.A., Koller B.H., Dupont B., Yang S.Y.;
RT   "Isolation and nucleotide sequence of a cDNA clone encoding a novel HLA
RT   class I gene";
RL   J. Immunol. 140(11):4024-4030(1988).
XX
DR   MD5; 71074ab264d446de3abfc4132e456bbb.
DR   Ensembl-Gn; ENSG00000206493; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229252; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230254; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233904; homo_sapiens.
DR   Ensembl-Tr; ENST00000383597; homo_sapiens.
DR   Ensembl-Tr; ENST00000415289; homo_sapiens.
DR   Ensembl-Tr; ENST00000415649; homo_sapiens.
DR   Ensembl-Tr; ENST00000427936; homo_sapiens.
DR   EuropePMC; PMC28094; 9861020.
DR   H-InvDB; HIT000194713_04.4.
DR   H-InvDB; HIT000194713_05.4.
DR   H-InvDB; HIT000194713_06.4.
XX
CC   Draft entry and Clean copy of sequence [1] kindly provided by
CC   S.Mizuno (08/09/88).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1665
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     8..71
FT                   /gene="HLA-E"
FT                   /note="HLA-E class I protein signal peptide"
FT   CDS             8..1084
FT                   /codon_start=1
FT                   /gene="HLA-E"
FT                   /note="HLA-E class I protein precursor"
FT                   /db_xref="GOA:P13747"
FT                   /db_xref="H-InvDB:HIT000194713_03.4"
FT                   /db_xref="HGNC:HGNC:4962"
FT                   /db_xref="IMGT/HLA:E*01:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1KPR"
FT                   /db_xref="PDB:1KTL"
FT                   /db_xref="PDB:1MHE"
FT                   /db_xref="PDB:2ESV"
FT                   /db_xref="PDB:3AM8"
FT                   /db_xref="PDB:3BZE"
FT                   /db_xref="PDB:3BZF"
FT                   /db_xref="PDB:3CDG"
FT                   /db_xref="PDB:3CII"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13747"
FT                   /protein_id="AAA52655.1"
FT                   /translation="MVDGTLLLLSSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFIS
FT                   VGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRG
FT                   YYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQI
FT                   SEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATL
FT                   RCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCH
FT                   VQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGS
FT                   YSKAEWSDSAQGSESHSL"
FT   mat_peptide     72..1081
FT                   /gene="HLA-E"
FT                   /note="HLA-E class I protein mature peptide"
XX
SQ   Sequence 1665 BP; 372 A; 465 C; 507 G; 321 T; 0 other;
     cgggatcatg gtagatggaa ccctcctttt actctcctcg gaggccctgg cccttaccca        60
     gacctgggcg ggctcccact ccttgaagta tttccacact tccgtgtccc ggcccggccg       120
     cggggagccc cgcttcatct ctgtgggcta cgtggacgac acccagttcg tgcgcttcga       180
     caacgacgcc gcgagtccga ggatggtgcc gcgggcgccg tggatggagc aggaggggtc       240
     agagtattgg gaccgggaga cacggagcgc cagggacacc gcacagattt tccgagtgaa       300
     cctgcggacg ctgcgcggct actacaatca gagcgaggcc gggtctcaca ccctgcagtg       360
     gatgcatggc tgcgagctgg ggcccgacag gcgcttcctc cgcgggtatg aacagttcgc       420
     ctacgacggc aaggattatc tcaccctgaa tgaggacctg cgctcctgga ccgcggtgga       480
     cacggcggct cagatctccg agcaaaagtc aaatgatgcc tctgaggcgg agcaccagag       540
     agcctacctg gaagacacat gcgtggagtg gctccacaaa tacctggaga aggggaagga       600
     gacgctgctt cacctggagc ccccaaagac acacgtgact caccacccca tctctgacca       660
     tgaggccacc ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg       720
     gcagcaggat ggggagggcc atacccagga cacggagctc gtggagacca ggcctgcagg       780
     ggatggaacc ttccagaagt gggcagctgt ggtggtgcct tctggagagg agcagagata       840
     cacgtgccat gtgcagcatg aggggctacc cgagcccgtc accctgagat ggaagccggc       900
     ttcccagccc accatcccca tcgtgggcat cattgctggc ctggttctcc ttggatctgt       960
     ggtctctgga gctgtggttg ctgctgtgat atggaggaag aagagctcag gtggaaaagg      1020
     agggagctac tctaaggctg agtggagcga cagtgcccag gggtctgagt ctcacagctt      1080
     gtaaagcctg agacagctgc cttgtgtgcg actgagatgc acagctgcct tgtgtgcgac      1140
     tgagatgcag gatttcctca cgcctcccct atgtgtctta ggggactctg gcttctcttt      1200
     ttgcaagggc ctctgaatct gtctgtgtcc ctgttagcac aatgtgagga ggtagagaaa      1260
     cagtccacct ctgtgtctac catgaccccc ttcctcacac tgacctgtgt tccttccctg      1320
     ttctcttttc tattaaaaat aagaacctgg gcagagtgcg gcagctcatg cctgtaatcc      1380
     cagcacttag ggaggccgag gagggcagat cacgaggtca ggagatcgaa accatcctgg      1440
     ctaacacggt gaaaccccgt ctctactaaa aaatacaaaa aattagctgg gcgcagaggc      1500
     acgggcctgt agtcccagct actcaggagg cggaggcatg gagaatggcg tcaacccggg      1560
     aggcggaggt tgcagtgagc caggattgtg cgactgcact ccagcctggg tgacagggtg      1620
     aaacgccatc tcaaaaaata aaaattaaaa aataaaaaaa gaacc                      1665
//