spacer

EBI Dbfetch

ID   M19757; SV 1; linear; genomic DNA; STD; HUM; 1093 BP.
XX
AC   M19757;
XX
DT   04-OCT-1988 (Rel. 17, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 12)
XX
DE   Human MHC class I HLA-B13 gene, complete cds.
XX
KW   antigen; cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1093
RX   DOI; 10.1007/BF00376123.
RX   PUBMED; 3257938.
RA   Zemmour J., Ennis P.D., Parham P., Dupont B.;
RT   "Comparison of the structure of HLA-Bw47 to HLA-B13 and its relationship to
RT   21-hydroxylase deficiency";
RL   Immunogenetics 27(4):281-287(1988).
XX
DR   MD5; 8b036b59ceee72ebaf7817b019571290.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1093
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     1..72
FT                   /gene="HLA-B"
FT                   /note="MHC HLA-B13 signal peptide"
FT   CDS             1..1089
FT                   /partial
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /note="MHC HLA-B13 precursor"
FT                   /db_xref="GOA:P30461"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*13:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30461"
FT                   /protein_id="AAA52657.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTQFVRFDSDATSPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQLKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   mat_peptide     73..1086
FT                   /gene="HLA-B"
FT                   /note="MHC HLA-B13"
XX
SQ   Sequence 1093 BP; 225 A; 336 C; 358 G; 174 T; 0 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat caccgtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccacgagtcc gaggatggcg ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac ttaccgagag       300
     aacctgcgca ccgcgctccg ctactacaac cagagcgagg ccgggtctca cacttggcag       360
     acgatgtatg gctgcgacct ggggccggac gggcgcctcc tccgcgggca taaccagtta       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagctcaag tgggaggcgg cccgtgtggc ggagcagctg       540
     agagcctacc tggagggcga gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccgtccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctgctgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtgcagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgaa aag                                                         1093
//


spacer
spacer