Dbfetch

ID   AH000042; SV 2; linear; genomic DNA; STD; HUM; 1294 BP.
XX
AC   AH000042; M17567; M17689; M19670;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens clone A2.3 DK1 lymphocyte antigen (HLA-A) gene, partial cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; lymphocyte antigen;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1294
RX   DOI; 10.1007/BF00365911.
RX   PUBMED; 3497874.
RA   Mattson D.H., Handy D.E., Bradley D.A., Coligan J.E., Cowan E.P.,
RA   Biddison W.E.;
RT   "DNA sequences of the genes that encode the CTL-defined HLA-A2 variants M7
RT   and DK1";
RL   Immunogenetics 26(3):190-192(1987).
XX
DR   MD5; 96d0651b604269fab8c16cc3342b5226.
XX
CC   On or before Jun 10, 2016 this sequence version replaced gi:187995,
CC   gi:187996, gi:187997, gi:187998.
CC   Draft entry and computer readable sequence for [1] kindly submitted
CC   by D.H.Mattson, 09-MAY-1988.  This entry is a variant of the MHC
CC   class I HLA-A2 gene whose complete cds is located under K02883.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1294
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="A2.3"
FT                   /cell_type="peripheral blood lymphocyte"
FT                   /db_xref="taxon:9606"
FT   intron          <1..28
FT                   /note="DK1 intron A"
FT   gene            29..1260
FT                   /gene="HLA-A"
FT   CDS             join(<29..298,520..795,985..>1260)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /note="DK1 lymphocyte antigen"
FT                   /protein_id="AAA03683.2"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWETAHEAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            <29..298
FT                   /gene="HLA-A"
FT                   /number=2
FT                   /note="DK1 lymphocyte antigen"
FT   intron          299..>357
FT                   /gene="HLA-A"
FT                   /note="DK1 intron B"
FT   gap             358..457
FT                   /estimated_length=unknown
FT   intron          <458..519
FT                   /gene="HLA-A"
FT                   /note="DK1 intron B"
FT   exon            520..795
FT                   /gene="HLA-A"
FT                   /number=3
FT                   /note="DK1 lymphocyte antigen"
FT   intron          796..>824
FT                   /gene="HLA-A"
FT                   /note="DK1 intron C"
FT   gap             836..935
FT                   /estimated_length=unknown
FT   intron          <936..984
FT                   /gene="HLA-A"
FT                   /note="DK1 intron C"
FT   exon            <985..1260
FT                   /gene="HLA-A"
FT                   /number=4
FT                   /note="DK1 lymphocyte antigen"
FT   intron          1261..>1294
FT                   /note="DK1 intron D"
XX
SQ   Sequence 1294 BP; 216 A; 329 C; 382 G; 167 T; 200 other;
     gcgggtctca gccactcctc gtccccaggc tctcactcca tgaggtattt cttcacatcc        60
     gtgtcccggc ccggccgcgg ggagccccgc ttcatcgcag tgggctacgt ggacgacacg       120
     cagttcgtgc ggttcgacag cgacgccgcg agccagagga tggagccgcg ggcgccgtgg       180
     atagagcagg agggtccgga gtattgggac ggggagacac ggaaagtgaa ggcccactca       240
     cagactcacc gagtggacct ggggaccctg cgcggctact acaaccagag cgaggccggt       300
     gagtgacccc ggcccggggc gcaggtcacg acctctcatc ccccacggac gggccagnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnccc aggttggtcg gggcggggcg       480
     gggctcgggg gaccgggctg accgcggggt ccgggccagg ttctcacacc gtccagagga       540
     tgtatggctg cgacgtgggg tcggactggc gcttcctccg cgggtaccac cagtacgcct       600
     acgacggcaa ggattacatc gccctgaaag aggacctgcg ctcttggacc gcggcggaca       660
     tggcagctca gaccaccaag cacaagtggg agacggccca tgaggcggag cagtggagag       720
     cctacctgga gggcacgtgc gtggagtggc tccgcagata cctggagaac gggaaggaga       780
     cgctgcagcg cacgggtacc aggggccacg gggcgcctcc ctgatcgcct gtagannnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngtccc atgacagatc gaaaatgcct       960
     gaatgatctg actcttcctg acagacgccc ccaaaacgca tatgactcac cacgctgtct      1020
     ctgaccatga agccaccctg aggtgctggg ccctgagctt ctaccctgcg gagatcacac      1080
     tgacctggca gcgggatggg gaggaccaga cccaggacac ggagctcgtg gagaccaggc      1140
     ctgcagggga tggaaccttc cagaagtggg cggctgtggt ggtgccttct ggacaggagc      1200
     agagatacac ctgccatgtg cagcatgagg gtttgcccaa gcccctcacc ctgagatggg      1260
     gtaaggaggg agacgggggt gtcatgtctt ttag                                  1294
//