spacer

EBI Dbfetch

ID   M19670; SV 1; linear; genomic DNA; STD; HUM; 359 BP.
XX
AC   M19670;
XX
DT   04-OCT-1988 (Rel. 17, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 11)
XX
DE   Human MHC class I lymphocyte antigen A2 gene (A2.1) variant DK1, exon 4 and
DE   partial cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; lymphocyte antigen;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-359
RX   DOI; 10.1007/BF00365911.
RX   PUBMED; 3497874.
RA   Mattson D.H., Handy D.E., Bradley D.A., Coligan J.E., Cowan E.P.,
RA   Biddison W.E.;
RT   "DNA sequences of the genes that encode the CTL-defined HLA-A2 variants M7
RT   and DK1";
RL   Immunogenetics 26(3):190-192(1987).
XX
DR   MD5; e28a49d1793edf5d69541c3d75e261d8.
DR   Ensembl-Gn; ENSG00000235657; homo_sapiens.
DR   Ensembl-Tr; ENST00000457879; homo_sapiens.
DR   Ensembl-Tr; ENST00000547271; homo_sapiens.
XX
CC   Draft entry and computer readable sequence for [1] kindly submitted
CC   by D.H.Mattson, 09-MAY-1988.  This entry is a variant of the MHC
CC   class I HLA-A2 gene whose complete cds is located under K02883.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..359
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="A2.3"
FT                   /cell_type="peripheral blood lymphocyte"
FT                   /db_xref="taxon:9606"
FT   intron          <1..49
FT                   /gene="HLA-A"
FT                   /note="DK1 intron C"
FT   CDS             join(M17567.1:<29..298,M17689.1:63..338,50..>325)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /note="DK1 lymphocyte antigen"
FT                   /db_xref="GOA:P01892"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*02:03:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1AKJ"
FT                   /db_xref="PDB:1AO7"
FT                   /db_xref="PDB:1AQD"
FT                   /db_xref="PDB:1B0G"
FT                   /db_xref="PDB:1B0R"
FT                   /db_xref="PDB:1BD2"
FT                   /db_xref="PDB:1DUY"
FT                   /db_xref="PDB:1DUZ"
FT                   /db_xref="PDB:1EEY"
FT                   /db_xref="PDB:1EEZ"
FT                   /db_xref="PDB:1HHG"
FT                   /db_xref="PDB:1HHH"
FT                   /db_xref="PDB:1HHI"
FT                   /db_xref="PDB:1HHJ"
FT                   /db_xref="PDB:1HHK"
FT                   /db_xref="PDB:1HLA"
FT                   /db_xref="PDB:1I1F"
FT                   /db_xref="PDB:1I1Y"
FT                   /db_xref="PDB:1I4F"
FT                   /db_xref="PDB:1I7R"
FT                   /db_xref="PDB:1I7T"
FT                   /db_xref="PDB:1I7U"
FT                   /db_xref="PDB:1IM3"
FT                   /db_xref="PDB:1JF1"
FT                   /db_xref="PDB:1JHT"
FT                   /db_xref="PDB:1LP9"
FT                   /db_xref="PDB:1OGA"
FT                   /db_xref="PDB:1P7Q"
FT                   /db_xref="PDB:1QEW"
FT                   /db_xref="PDB:1QR1"
FT                   /db_xref="PDB:1QRN"
FT                   /db_xref="PDB:1QSE"
FT                   /db_xref="PDB:1QSF"
FT                   /db_xref="PDB:1S8D"
FT                   /db_xref="PDB:1S9W"
FT                   /db_xref="PDB:1S9X"
FT                   /db_xref="PDB:1S9Y"
FT                   /db_xref="PDB:1T1W"
FT                   /db_xref="PDB:1T1X"
FT                   /db_xref="PDB:1T1Y"
FT                   /db_xref="PDB:1T1Z"
FT                   /db_xref="PDB:1T20"
FT                   /db_xref="PDB:1T21"
FT                   /db_xref="PDB:1T22"
FT                   /db_xref="PDB:1TVB"
FT                   /db_xref="PDB:1TVH"
FT                   /db_xref="PDB:1UR7"
FT                   /db_xref="PDB:2AV1"
FT                   /db_xref="PDB:2AV7"
FT                   /db_xref="PDB:2BNQ"
FT                   /db_xref="PDB:2BNR"
FT                   /db_xref="PDB:2C7U"
FT                   /db_xref="PDB:2CLR"
FT                   /db_xref="PDB:2F53"
FT                   /db_xref="PDB:2F54"
FT                   /db_xref="PDB:2GIT"
FT                   /db_xref="PDB:2GJ6"
FT                   /db_xref="PDB:2GT9"
FT                   /db_xref="PDB:2GTW"
FT                   /db_xref="PDB:2GTZ"
FT                   /db_xref="PDB:2GUO"
FT                   /db_xref="PDB:2J8U"
FT                   /db_xref="PDB:2JCC"
FT                   /db_xref="PDB:2P5E"
FT                   /db_xref="PDB:2P5W"
FT                   /db_xref="PDB:2PYE"
FT                   /db_xref="PDB:2UWE"
FT                   /db_xref="PDB:2V2W"
FT                   /db_xref="PDB:2V2X"
FT                   /db_xref="PDB:2VLJ"
FT                   /db_xref="PDB:2VLK"
FT                   /db_xref="PDB:2VLL"
FT                   /db_xref="PDB:2VLR"
FT                   /db_xref="PDB:2X4N"
FT                   /db_xref="PDB:2X4O"
FT                   /db_xref="PDB:2X4P"
FT                   /db_xref="PDB:2X4Q"
FT                   /db_xref="PDB:2X4R"
FT                   /db_xref="PDB:2X4S"
FT                   /db_xref="PDB:2X4T"
FT                   /db_xref="PDB:2X4U"
FT                   /db_xref="PDB:2X70"
FT                   /db_xref="PDB:3BGM"
FT                   /db_xref="PDB:3BH8"
FT                   /db_xref="PDB:3BH9"
FT                   /db_xref="PDB:3BHB"
FT                   /db_xref="PDB:3D25"
FT                   /db_xref="PDB:3D39"
FT                   /db_xref="PDB:3D3V"
FT                   /db_xref="PDB:3FQN"
FT                   /db_xref="PDB:3FQR"
FT                   /db_xref="PDB:3FQT"
FT                   /db_xref="PDB:3FQU"
FT                   /db_xref="PDB:3FQW"
FT                   /db_xref="PDB:3FQX"
FT                   /db_xref="PDB:3FT2"
FT                   /db_xref="PDB:3FT3"
FT                   /db_xref="PDB:3FT4"
FT                   /db_xref="PDB:3GIV"
FT                   /db_xref="PDB:3GJF"
FT                   /db_xref="PDB:3GSN"
FT                   /db_xref="PDB:3GSO"
FT                   /db_xref="PDB:3GSQ"
FT                   /db_xref="PDB:3GSR"
FT                   /db_xref="PDB:3GSU"
FT                   /db_xref="PDB:3GSV"
FT                   /db_xref="PDB:3GSW"
FT                   /db_xref="PDB:3GSX"
FT                   /db_xref="PDB:3H7B"
FT                   /db_xref="PDB:3H9H"
FT                   /db_xref="PDB:3H9S"
FT                   /db_xref="PDB:3HAE"
FT                   /db_xref="PDB:3HLA"
FT                   /db_xref="PDB:3HPJ"
FT                   /db_xref="PDB:3I6G"
FT                   /db_xref="PDB:3I6K"
FT                   /db_xref="PDB:3IXA"
FT                   /db_xref="PDB:3KLA"
FT                   /db_xref="PDB:3MGO"
FT                   /db_xref="PDB:3MGT"
FT                   /db_xref="PDB:3MR9"
FT                   /db_xref="PDB:3MRB"
FT                   /db_xref="PDB:3MRC"
FT                   /db_xref="PDB:3MRD"
FT                   /db_xref="PDB:3MRE"
FT                   /db_xref="PDB:3MRF"
FT                   /db_xref="PDB:3MRG"
FT                   /db_xref="PDB:3MRH"
FT                   /db_xref="PDB:3MRI"
FT                   /db_xref="PDB:3MRJ"
FT                   /db_xref="PDB:3MRK"
FT                   /db_xref="PDB:3MRL"
FT                   /db_xref="PDB:3MRM"
FT                   /db_xref="PDB:3MRN"
FT                   /db_xref="PDB:3MRO"
FT                   /db_xref="PDB:3MRP"
FT                   /db_xref="PDB:3MRQ"
FT                   /db_xref="PDB:3MRR"
FT                   /db_xref="PDB:3MYJ"
FT                   /db_xref="PDB:3O3A"
FT                   /db_xref="PDB:3O3B"
FT                   /db_xref="PDB:3O3D"
FT                   /db_xref="PDB:3O3E"
FT                   /db_xref="PDB:3O4L"
FT                   /db_xref="PDB:3PWJ"
FT                   /db_xref="PDB:3PWL"
FT                   /db_xref="PDB:3PWN"
FT                   /db_xref="PDB:3PWP"
FT                   /db_xref="PDB:3QDG"
FT                   /db_xref="PDB:3QDJ"
FT                   /db_xref="PDB:3QDM"
FT                   /db_xref="PDB:3QEQ"
FT                   /db_xref="PDB:3QFD"
FT                   /db_xref="PDB:3QFJ"
FT                   /db_xref="PDB:3REW"
FT                   /db_xref="PDB:3TO2"
FT                   /db_xref="PDB:3UTQ"
FT                   /db_xref="PDB:3UTS"
FT                   /db_xref="PDB:3UTT"
FT                   /db_xref="PDB:3V5D"
FT                   /db_xref="PDB:3V5H"
FT                   /db_xref="PDB:3V5K"
FT                   /db_xref="PDB:4E5X"
FT                   /db_xref="PDB:4EMZ"
FT                   /db_xref="PDB:4EN2"
FT                   /db_xref="PDB:4EUP"
FT                   /db_xref="PDB:4EUQ"
FT                   /db_xref="PDB:4FTV"
FT                   /db_xref="PDB:4GKN"
FT                   /db_xref="PDB:4GKS"
FT                   /db_xref="PDB:4I4W"
FT                   /db_xref="PDB:4JFD"
FT                   /db_xref="PDB:4JFE"
FT                   /db_xref="PDB:4JFF"
FT                   /db_xref="PDB:4JFO"
FT                   /db_xref="PDB:4JFP"
FT                   /db_xref="PDB:4JFQ"
FT                   /db_xref="PDB:4K7F"
FT                   /db_xref="PDB:4L29"
FT                   /db_xref="PDB:4L3C"
FT                   /db_xref="PDB:4L3E"
FT                   /db_xref="PDB:4MNQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01892"
FT                   /protein_id="AAA03683.2"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWETAHEAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            <50..325
FT                   /gene="HLA-A"
FT                   /number=4
FT                   /note="DK1 lymphocyte antigen"
FT   intron          326..>359
FT                   /note="DK1 intron D"
XX
SQ   Sequence 359 BP; 81 A; 99 C; 113 G; 66 T; 0 other;
     gtcccatgac agatcgaaaa tgcctgaatg atctgactct tcctgacaga cgcccccaaa        60
     acgcatatga ctcaccacgc tgtctctgac catgaagcca ccctgaggtg ctgggccctg       120
     agcttctacc ctgcggagat cacactgacc tggcagcggg atggggagga ccagacccag       180
     gacacggagc tcgtggagac caggcctgca ggggatggaa ccttccagaa gtgggcggct       240
     gtggtggtgc cttctggaca ggagcagaga tacacctgcc atgtgcagca tgagggtttg       300
     cccaagcccc tcaccctgag atggggtaag gagggagacg ggggtgtcat gtcttttag        359
//


spacer
spacer