spacer

EBI Dbfetch

ID   M17388; SV 1; linear; mRNA; STD; HUM; 258 BP.
XX
AC   M17388;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human MHC class II HLA-DR-beta mRNA (DR9), partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-258
RX   DOI; 10.1073/pnas.84.17.6234.
RX   PUBMED; 3476943.
RA   Bell J.I., Denney D.Jr., Foster L., Belt T.K., Todd J.A., McDevitt H.O.;
RT   "Allelic variation in the DR subregion of the human major
RT   histocompatibility complex";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(17):6234-6238(1987).
XX
DR   MD5; 2792aeae2ba70b5ea059028d26158e94.
DR   Ensembl-Gn; ENSG00000227357; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231021; homo_sapiens.
DR   Ensembl-Tr; ENST00000411565; homo_sapiens.
DR   Ensembl-Tr; ENST00000411959; homo_sapiens.
DR   Ensembl-Tr; ENST00000457451; homo_sapiens.
DR   H-InvDB; HIT000194538_03.4.
DR   H-InvDB; HIT000194538_04.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..258
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>258
FT                   /codon_start=1
FT                   /note="MHC HLA-DR-beta cell surface glycoprotein"
FT                   /db_xref="GOA:O19740"
FT                   /db_xref="H-InvDB:HIT000194538_02.4"
FT                   /db_xref="IMGT/HLA:DRB4*01:01:01:01"
FT                   /db_xref="IMGT/HLA:DRB4*01:03:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19740"
FT                   /protein_id="AAA36299.1"
FT                   /translation="GDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLG
FT                   EYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVV"
XX
SQ   Sequence 258 BP; 63 A; 63 C; 89 G; 43 T; 0 other;
     ggggacaccc aaccacgttt cttggagcag gctaagtgtg agtgtcattt cctcaatggg        60
     acggagcgag tctggaacct gatcagatac atctataacc aagaggagta cgcgcgctac       120
     aacagtgacc tgggggagta ccaggcggtg acggagctgg ggcggcctga cgccgagtac       180
     tggaacagcc agaaggacct cctggagcgg aggcgggccg aggtggacac ctactgcaga       240
     tacaactacg gggttgtg                                                     258
//


spacer
spacer